The domain within your query sequence starts at position 19 and ends at position 303; the E-value for the DUF1907 domain shown below is 3.83e-200.

VLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLLPLVNKKKVY
DLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADG
ACLLEKYSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD
KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP
GLDLRLEHTHFFSHHGEGGHYHYDTTPDTVEYLGYFSPAQFLYRI

DUF1907

DUF1907
SMART accession number:SM01168
Description: The structure of this domain displays an alpha-beta-beta-alpha four layer topology, with an HxHxxxxxxxxxH motif that coordinates a zinc ion, and an acetate anion at a site that likely supports the enzymatic activity of an ester hydrolase [(PUBMED:16522806)].
Interpro abstract (IPR015021):

The structure of this domain displays an alpha-beta-beta-alpha four layer topology, with an HxHxxxxxxxxxH motif that coordinates a zinc ion, and an acetate anion at a site that likely supports the enzymatic activity of an ester hydrolase [(PUBMED:16522806)].

GO component:nucleus (GO:0005634)
Family alignment:
View or

There are 969 DUF1907 domains in 967 proteins in SMART's nrdb database.

Click on the following links for more information.