The domain within your query sequence starts at position 19 and ends at position 303; the E-value for the DUF1907 domain shown below is 3.83e-200.
VLQKGLTDNFADVQVSVVDCPDLTKEPFTFPVRGICGQTRIAEVGGVPYLLPLVNKKKVY DLNEIAKVIKLPGAFILGAGAGPFQTLGFNSEFMPIVQTASEHNQPVNGSYFAHKNPADG ACLLEKYSQKYHDFGCALLANLFASEGQPGKVIEVQAKRRTGELNFVSCMRQTLEEHYGD KPVGMGGTFIVQKGKVKAHIMPAEFSSCPLNSDEAVNKWLHFYEMKAPLVCLPVFVSKDP GLDLRLEHTHFFSHHGEGGHYHYDTTPDTVEYLGYFSPAQFLYRI
DUF1907 |
---|
SMART accession number: | SM01168 |
---|---|
Description: | The structure of this domain displays an alpha-beta-beta-alpha four layer topology, with an HxHxxxxxxxxxH motif that coordinates a zinc ion, and an acetate anion at a site that likely supports the enzymatic activity of an ester hydrolase [(PUBMED:16522806)]. |
Interpro abstract (IPR015021): | The structure of this domain displays an alpha-beta-beta-alpha four layer topology, with an HxHxxxxxxxxxH motif that coordinates a zinc ion, and an acetate anion at a site that likely supports the enzymatic activity of an ester hydrolase [ (PUBMED:16522806) ]. |
GO component: | nucleus (GO:0005634) |
Family alignment: |
There are 969 DUF1907 domains in 967 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)