The domain within your query sequence starts at position 854 and ends at position 1024; the E-value for the DUF3385 domain shown below is 1.51e-93.

VVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDAS
AVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQ
AITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVK

DUF3385

Domain of unknown function
DUF3385
SMART accession number:SM01346
Description: This domain is found in eukaryotes.
Interpro abstract (IPR024585):

This uncharacterised domain is is typically between 160 to 172 amino acids in length. It is found in the phosphatidylinositol kinase-related protein kinases TOR (target of rapamycin). In Saccharomyces cerevisiae the TOR proteins, TOR1 and TOR2, regulate growth in a rapamycin-sensitive manner [(PUBMED:12408816)].

Family alignment:
View or

There are 1788 DUF3385 domains in 1786 proteins in SMART's nrdb database.

Click on the following links for more information.