The domain within your query sequence starts at position 2218 and ends at position 2275; the E-value for the DUF3454 domain shown below is 2.81e-20.

GEEYPAAGTRSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPAT

DUF3454

Domain of unknown function
DUF3454
SMART accession number:SM01334
Description: -
Interpro abstract (IPR024600):

This functionally uncharacterised domain is found in notch and notch-related proteins.

Family alignment:
View or

There are 1108 DUF3454 domains in 1107 proteins in SMART's nrdb database.

Click on the following links for more information.