The domain within your query sequence starts at position 10 and ends at position 112; the E-value for the DUF3585 domain shown below is 1.07e-3.

HLEAEKPLRRYGAVEETAWKAEGLGSQLDIISMAETSMMPEEIELEMAKIQRLREVLVRR
ESELRFMMDDIQLCKDIMDLKQELQNLVAIPGNRKKTRKWLIS

DUF3585

DUF3585
SMART accession number:SM01203
Description: This domain is found in eukaryotes. This domain is typically between 135 and 149 amino acids in length and is found associated with the CH domain.
Family alignment:
View or

There are 6259 DUF3585 domains in 6259 proteins in SMART's nrdb database.

Click on the following links for more information.