The domain within your query sequence starts at position 195 and ends at position 263; the E-value for the DUF4187 domain shown below is 1.51e-25.
EEETEEEEEEKEEQDEDECPSEDLSVLEKLQILTGYLREEHLYCIWCGTAYEDKEDLSSN CPGPTSADH
DUF4187 |
---|
SMART accession number: | SM01173 |
---|---|
Description: | This family is found at the very C-terminus of proteins that carry a G-patch domain SM00443. The domain is short and cysteine-rich . |
Interpro abstract (IPR025239): | This short, cysteine-rich domain is often found C-terminal to a G-patch domain. |
Family alignment: |
There are 1672 DUF4187 domains in 1670 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)