The domain within your query sequence starts at position 195 and ends at position 263; the E-value for the DUF4187 domain shown below is 1.51e-25.

EEETEEEEEEKEEQDEDECPSEDLSVLEKLQILTGYLREEHLYCIWCGTAYEDKEDLSSN
CPGPTSADH

DUF4187

DUF4187
SMART accession number:SM01173
Description: This family is found at the very C-terminus of proteins that carry a G-patch domain SM00443. The domain is short and cysteine-rich .
Interpro abstract (IPR025239):

This short, cysteine-rich domain is often found C-terminal to a G-patch domain.

Family alignment:
View or

There are 1672 DUF4187 domains in 1670 proteins in SMART's nrdb database.

Click on the following links for more information.