The domain within your query sequence starts at position 403 and ends at position 739; the E-value for the DUF4205 domain shown below is 1.47e-187.

KTLLFGSTFCCFSEEWKLQNFSFNDIASLKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGD
NRTNSNLRLQPSDAQRTRCLALAIADILWRAGGKEQAVVALASGTPHFSPTGKYKADGVL
ETLTLYSLTSSEDLVTFIQQSVHQFEAGPYGCILLTLSAILSRSLELVRQDFDVPTSHLI
GAHGYCTQELVNLLLTGRAVSNVFNDVVELDSGDGNITLLRGIEARSDIGFLSLFEHYNV
CQVGCFLKTPRFPIWVVCSESHFSILFSLQPELLCDWRSERLFDLYYYDGLANQQEEIRL
TVDTTKTAPADSCSDLVPPLELCIRTKWKGASVNWNG

DUF4205

DUF4205
SMART accession number:SM01174
Description: The proteins in this family are uncharacterized but often named FAM188B.
Interpro abstract (IPR025257): The function of this domain is not known.
Family alignment:
View or

There are 1902 DUF4205 domains in 1902 proteins in SMART's nrdb database.

Click on the following links for more information.