The domain within your query sequence starts at position 878 and ends at position 936; the E-value for the DUF4210 domain shown below is 8.5e-29.

LLGNFEESVLNYRLDPLGIVDGFTAEVGASGTFCPTHLTLPVEVSFYSVSDDNAPSPYM

DUF4210

DUF4210
SMART accession number:SM01177
Description: This short domain is found in fungi, plants and animals, and the proteins appear to be necessary for chromosome segregation during meiosis.
Interpro abstract (IPR025261):

The function of this domain is not known. Proteins containing this domain includes the animal FAM214 proteins and the fission yeast SPAC3H8.04 protein. From a high-throughput knockout screen, SPAC3H8.04 was identified as a protein required for meiotic chromosome segregation [ (PUBMED:16169489) ].

Family alignment:
View or

There are 1631 DUF4210 domains in 1630 proteins in SMART's nrdb database.

Click on the following links for more information.