The domain within your query sequence starts at position 486 and ends at position 772; the E-value for the DUF663 domain shown below is 2.6e-179.
EMDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPRDYARIFQFQNFVNTRKRIFKEIEE KEAEGAEVGWYVTLHVSDVPVSVVEYFRQGAPLIAFSLLPYEQKMSVLNMVVSRNPGNTE PVKAKEELIFHCGFRRFRASPLFSQHTAADKHKFQRFLTADAAFVVTVFAPITFPPASVL LFKQRRNGMHSLIATGHLFSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVMWF KPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRV
DUF663Protein of unknown function (DUF663) |
---|
SMART accession number: | SM01362 |
---|---|
Description: | This family contains several uncharacterised eukaryotic proteins. |
Interpro abstract (IPR007034): | This domain is found at the C terminus of the ribosome biogenesis protein BMS1 and TSR1 families, which may act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus. |
Family alignment: |
There are 4014 DUF663 domains in 4011 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)