The domain within your query sequence starts at position 398 and ends at position 571; the E-value for the Dak2 domain shown below is 1.47e-58.

AAGDGDCGSTHSRAAKAIQGWLKEGPSLTSPAQVLSRLSVLLLERMGGSSGALYGLFLTA
AAQPLKAKTDLPTWSAAMDAGLESMQKYGKAAPGDRTMLDSLWAAAQEFQAWKSPGASLL
PVLTKAVKSAEAAAEATKNMEAGAGRASYISSAQLDQPDPGAVAAAAIFRAILE

Dak2

Dak2
SMART accession number:SM01120
Description: This domain is the predicted phosphatase domain of the dihydroxyacetone kinase family.
Interpro abstract (IPR004007):

Dihydroxyacetone (Dha) kinases are a family of sequence-conserved enzymes that phosphorylate dihydroxyacetone, glyceraldehyde and other short-chain ketoses and aldoses. They can be divided into two groups according to the source of high-energy phosphate that they utilise, either ATP or phosphoenolpyruvate (PEP). The ATP-dependent forms are the two-domain Dha kinases (DAK), which occur in animals, plants and eubacteria. They consist of a Dha binding (K) and an ATP binding (L) domain. The PEP-dependent forms occur only in eubacteria and a few archaebacteria and consist of three subunits. Two subunits, DhaK and DhaL, are homologous to the K and L domains. Intriguingly, the ADP moiety is not exchanged for ATP but remains permanently bound to the DhaL subunit where it is rephosphorylated in situ by the third subunit, DhaM, which is homologous to the IIA domain of the mannose transporter of the bacterial PEP:sugar phosphotransferase system (PTS) [ (PUBMED:16647083) (PUBMED:18957416) ].

The DhaL domain consists of eight antiparallel alpha-helices arranged in an up-and-down geometry and aligned on a circle. This results in the formation of a helix barrel enclosing a deep pocket. The helices are amphipathic with the hydrophobic side chains directed into the pocket of the barrel and with the polar residues exposed. The nucleotide is bound on the top of the barrel [ (PUBMED:16647083) (PUBMED:12966101) ].

The DhaL alpha helix barrel fold appears not only as a C-terminal domain in Dha kinases but also as an N-terminal domain in a family of two-domain proteins with unknown function. One representative example is YfhG of Lactococcus lactis [ (PUBMED:12966101) ].

GO process:glycerol metabolic process (GO:0006071)
GO function:glycerone kinase activity (GO:0004371)
Family alignment:
View or

There are 19627 Dak2 domains in 19624 proteins in SMART's nrdb database.

Click on the following links for more information.