The domain within your query sequence starts at position 230 and ends at position 422; the E-value for the Drf_FH3 domain shown below is 2.06e-68.

DMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITPAEELDFRVH
IRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEV
FQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFK
CRHLQIDIERLVD

Drf_FH3

Diaphanous FH3 Domain
Drf_FH3
SMART accession number:SM01139
Description: This region is found in the Formin-like and and diaphanous proteins [(PUBMED:12676083),(PUBMED:9606213)]
Interpro abstract (IPR010472):

Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [(PUBMED:10631086)]. Formins are multidomain proteins that interact with diverse signalling molecules and cytoskeletal proteins, although some formins have been assigned functions within the nucleus. Formins are characterised by the presence of three FH domains (FH1, FH2 and FH3), although members of the formin family do not necessarily contain all three domains [(PUBMED:12538772)]. The proline-rich FH1 domain mediates interactions with a variety of proteins, including the actin-binding protein profilin, SH3 (Src homology 3) domain proteins, and WW domain proteins. The FH2 domain (IPR015425) is required to inhibit actin polymerisation. The FH3 domain is less well conserved and is required for directing formins to the correct intracellular location, such the mitotic spindle [(PUBMED:11171383)], or the projection tip during conjugation [(PUBMED:9606213)]. In addition, some formins can contain a GTPase-binding domain (GBD) (IPR010473) required for binding to Rho small GTPases, and a C-terminal conserved Dia-autoregulatory domain (DAD).

This entry represents the FH3 domain.

GO process:cellular component organization (GO:0016043)
GO function:actin binding (GO:0003779)
Family alignment:
View or

There are 6079 Drf_FH3 domains in 6072 proteins in SMART's nrdb database.

Click on the following links for more information.