The domain within your query sequence starts at position 23 and ends at position 275; the E-value for the Drf_GBD domain shown below is 1.19e-96.

LPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHTYIQK
LKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSF
AQYAVTFDFESVESTMESTVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNT
LPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRT
KALVLELLAAVCL

Drf_GBD

Diaphanous GTPase-binding Domain
Drf_GBD
SMART accession number:SM01140
Description: This domain is bound to by GTP-attached Rho proteins, leading to activation of the Drf protein.
Interpro abstract (IPR010473):

Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [(PUBMED:10631086)]. Drf proteins are characterised by a variety of shared domains: an N-terminal GTPase-binding domain (GBD), formin-homology domains FH1, FH2 (IPR015425) and FH3 (IPR010472), and a C-terminal conserved Dia-autoregulatory domain (DAD) that binds the GBD.

This entry represents the GBD, which is a bifunctional autoinhibitory domain that interacts with and is regulated by activated Rho family members. Mammalian Drf3 contains a CRIB-like motif within its GBD for binding to Cdc42, which is required for Cdc42 to activate and guide Drf3 towards the cell cortex where it remodels the actin skeleton [(PUBMED:12676083)].

GO process:actin cytoskeleton organization (GO:0030036)
GO function:Rho GTPase binding (GO:0017048), actin binding (GO:0003779)
Family alignment:
View or

There are 6608 Drf_GBD domains in 6601 proteins in SMART's nrdb database.

Click on the following links for more information.