The domain within your query sequence starts at position 1 and ends at position 88; the E-value for the Dynein_light domain shown below is 1.67e-59.

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKS

Dynein_light

Dynein light chain type 1
Dynein_light
SMART accession number:SM01375
Description: -
Interpro abstract (IPR001372):

Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Dynein is composed of a number of ATP-binding large subunits (see IPR004273 ), intermediate size subunits and small subunits. Among the small subunits, there is a family of highly conserved proteins which make up this family [ (PUBMED:7744782) (PUBMED:8628263) ].

Both type 1 (DLC1) and 2 (DLC2) dynein light chains have a similar two-layer alpha-beta core structure consisting of beta-alpha(2)-beta-X-beta(2) [ (PUBMED:10426949) (PUBMED:14561217) ].

GO process:microtubule-based process (GO:0007017)
GO component:dynein complex (GO:0030286)
Family alignment:
View or

There are 4882 Dynein_light domains in 4751 proteins in SMART's nrdb database.

Click on the following links for more information.