The domain within your query sequence starts at position 244 and ends at position 274; the E-value for the EGF_like domain shown below is 7.23e1.

VCKQGCNLLHGGCTVPGECRCSYGWQGKFCD

EGF_like

EGF domain, unclasssified subfamily
EGF_like
SMART accession number:SM00001
Description: -
Family alignment:
View or

There are 116148 EGF_like domains in 57115 proteins in SMART's nrdb database.

Click on the following links for more information.