The domain within your query sequence starts at position 202 and ends at position 421; the E-value for the Elp3 domain shown below is 1.88e-40.

PLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVERAKQSFQEGVCEIWLTSEDTGA
YGRDIGTDLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPV
QSASDSVLMDMKREYCVADFKRVVDFLKEKVPGITIATDIICGFPGETDQDFQETVKLVE
EYKFPSLFINQFYPRPGTPAAKAEQVPAHVKKQRTKDLSR

Elp3

Elongator protein 3, MiaB family, Radical SAM
Elp3
SMART accession number:SM00729
Description: This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
Interpro abstract (IPR006638):

This domain is found in MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases [ (PUBMED:11222759) ].

GO function:catalytic activity (GO:0003824), iron-sulfur cluster binding (GO:0051536)
Family alignment:
View or

There are 276946 Elp3 domains in 276201 proteins in SMART's nrdb database.

Click on the following links for more information.