The domain within your query sequence starts at position 311 and ends at position 357; the E-value for the FA domain shown below is 9e-22.

KGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSSKRYTMSRS

FA

FERM adjacent (FA)
FA
SMART accession number:SM01195
Description: This region is found adjacent to Band 4.1 / FERM domains in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase (PUBMED:16626485). .
Interpro abstract (IPR014847):

This region is found adjacent to Band 4.1 / FERM domains ( IPR000299 ) in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase substrates [ (PUBMED:16626485) ].

Family alignment:
View or

There are 11691 FA domains in 11679 proteins in SMART's nrdb database.

Click on the following links for more information.