The domain within your query sequence starts at position 276 and ends at position 427; the E-value for the FA58C domain shown below is 1.63e-45.

QCNVPLGMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRF
LTMLTAIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVL
NKLHMPLLTRFIRIRPQTWHLGIALRLELFGC

FA58C

Coagulation factor 5/8 C-terminal domain, discoidin domain
FA58C
SMART accession number:SM00231
Description: Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.
Interpro abstract (IPR000421):

Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain. In the Dictyostelium discoideum (Slime mold) cell adhesion protein discoidin, a related domain, named discoidin I-like domain, DLD, or DS, has been found which shares a common C-terminal region of about 110 amino acids with the FA58C domain, but whose N-terminal 40 amino acids are much less conserved. Similar domains have been detected in other extracellular and membrane proteins [ (PUBMED:3092220) (PUBMED:8390675) (PUBMED:8639264) ] In coagulation factors V and VIII the repeated domains compose part of a larger functional domain which promotes binding to anionic phospholipids on the surface of platelets and endothelial cells [ (PUBMED:3125864) ]. The C-terminal domain of the second FA58C repeat (C2) of coagulation factor VIII has been shown to be responsible for phosphatidylserine-binding and essential for activity [ (PUBMED:2110840) (PUBMED:7515064) ]. It forms an amphipathic alpha-helix, which binds to the membrane [ (PUBMED:7893714) ]. FA58C contains two conserved cysteines in most proteins, which link the extremities of the domain by a disulphide bond [ (PUBMED:8504111) (PUBMED:7613471) (PUBMED:8856064) ]. A further disulphide bond is located near the C-terminal of the second FA58C domain in MFGM Q08431 [ (PUBMED:8856064) ].



+------------------------------------------------------------------------+
| +-+ |
| | | |
CxPLGxxQITASxxxxxRLxxxWxxxxWxxxxxxQGxxxxxxxxxxxxGNxxxxxxxxxxRxPxcxcLRxExGC

'C': conserved cysteine involved in a disulphide bond.
'c': cysteine involved in a disulphide bond in MFGM

.
'x': any amino acid.
upper case letters: conserved residues.

Family alignment:
View or

There are 23298 FA58C domains in 16898 proteins in SMART's nrdb database.

Click on the following links for more information.