The domain within your query sequence starts at position 5 and ends at position 168; the E-value for the FACT-Spt16_Nlob domain shown below is 2.95e-87.

LDKDAYYRRVKRLYSNWRKGEDEYASIDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDT
IMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLVREKNESNKSSFDKMIDA
IKESKSGKKIGVFSKDKFPGEFMKSWSDCLNKEGFDKVDISAVV

FACT-Spt16_Nlob

FACT complex subunit SPT16 N-terminal lobe domain
FACT-Spt16_Nlob
SMART accession number:SM01285
Description: The FACT or facilitator of chromatin transcription complex binds to and alters the properties of nucleosomes. This family represents the N-terminal lobe of the NTD, or N-terminal domain, and acts as a protein-protein interaction domain presumably with partners outside of the FACT complex PMID:18089575. Knockout of the whole NTD domain, 1-450 residues in UniProt:P32558 in yeast serves to tender the cells sensitive to DNA replication stress but is not lethal. The C-terminal half of NTD is structurally similar to aminopeptidases, and the most highly conserved surface residues line a cleft equivalent to the aminopeptidase substrate-binding site, family peptidase_M24, (PFAM:PF00557) PMID:18089575
Interpro abstract (IPR029148):

Spt16 is a component of the FACT (facilitator of chromatin transcription) complex, a general chromatin factor that acts to reorganise nucleosomes [ (PUBMED:12815073) (PUBMED:10413469) ]. In budding yeasts, the N-terminal domain (NTD) of Spt16 includes a smaller N-terminal lobe (residues 1-175) and a larger C-terminal lobe (residues 176-447). This entry represents the N-terminal lobe domain. Its structure is similar to the RuvC/RNase H family. It may act as a protein-protein interaction domain presumably with partners outside of the FACT complex [ (PUBMED:18089575) ]. The C-terminal lobe of NTD is structurally similar to aminopeptidases, and the most highly conserved surface residues line a cleft equivalent to the aminopeptidase substrate-binding site in peptidase family M24 ( IPR000994 ).

Family alignment:
View or

There are 1566 FACT-Spt16_Nlob domains in 1566 proteins in SMART's nrdb database.

Click on the following links for more information.