The domain within your query sequence starts at position 303 and ends at position 371; the E-value for the FANCL_C domain shown below is 7.55e-44.
FSMDCGICYARHLNGAIPDQVCNNPQCGQPFHEICLYEWLRGLSTSRQSFNVFFGDCPYC SKPITLKMS
FANCL_CFANCL C-terminal domain |
---|
SMART accession number: | SM01197 |
---|---|
Description: | This domain is found at the C-terminus of the Fancl protein in humans which is the putative E3 ubiquitin ligase subunit of the FA complex (Fanconi anaemia). Eight subunits of the Fanconi anaemia gene products form a multisubunit nuclear complex which is required for mono-ubiquitination of a downstream FA protein, FANCD2. |
Family alignment: |
There are 701 FANCL_C domains in 701 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)