The domain within your query sequence starts at position 276 and ends at position 374; the E-value for the FAS1 domain shown below is 6.75e-34.

TLLAPTNEAFEKIPAETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGMSMETLGGTTL
EVGCSGDKLTINGKAVISNKDILATNGVIHFIDELLIPD

FAS1

Four repeated domains in the Fasciclin I family of proteins, present in many other contexts.
FAS1
SMART accession number:SM00554
Description: -
Interpro abstract (IPR000782):

The FAS1 (fasciclin-like) domain is an extracellular module of about 140 amino acid residues. It has been suggested that the FAS1 domain represents an ancient cell adhesion domain common to plants and animals [ (PUBMED:7925267) ]; related FAS1 domains are also found in bacteria [ (PUBMED:7822037) ].

The crystal structure of FAS1 domains 3 and 4 of fasciclin I from Drosophila melanogaster (Fruit fly) has been determined, revealing a novel domain fold consisting of a seven-stranded beta wedge and at least five alpha helices; two well-ordered N-acetylglucosamine groups attached to a conserved asparagine are located in the interface region between the two FAS1 domains [ (PUBMED:12575939) ]. Fasciclin I is an insect neural cell adhesion molecule involved in axonal guidance that is attached to the membrane by a GPI-anchored protein.

FAS1 domains are present in many secreted and membrane-anchored proteins. These proteins are usually GPI anchored and consist of: (i) a single FAS1 domain, (ii) a tandem array of FAS1 domains, or (iii) FAS1 domain(s) interspersed with other domains.

Proteins known to contain a FAS1 domain include:

  • Fasciclin I (4 FAS1 domains).
  • Human TGF-beta induced Ig-H3 (BIgH3) protein (4 FAS1 domains), where the FAS1 domains mediate cell adhesion through an interaction with alpha3/beta1 integrin; mutation in the FAS1 domains result in corneal dystrophy [ (PUBMED:10906123) ].
  • Volvox major cell adhesion protein (2 FAS1 domains) [ (PUBMED:7925267) ].
  • Arabidopsis fasciclin-like arabinogalactan proteins (2 FAS1 domains) [ (PUBMED:16944204) ].
  • Mammalian stabilin protein, a family of fasciclin-like hyaluronan receptor homologues (7 FAS1 domains)[ (PUBMED:15345724) ].
  • Human extracellular matrix protein periostin (4 FAS1 domains).
  • Bacterial immunogenic protein MPT70 (1 FAS1 domain) [ (PUBMED:7871388) ].

The FAS1 domains of both human periostin ( Q15063 ) and BIgH3 ( Q15582 ) proteins were found to contain vitamin K-dependent gamma-carboxyglutamate residues [ (PUBMED:18450759) ]. Gamma-carboxyglutamate residues are more commonly associated with GLA domains ( IPR000294 ), where they occur through post-translational modification catalysed by the vitamin K-dependent enzyme gamma-glutamylcarboxylase.

Family alignment:
View or

There are 36584 FAS1 domains in 21188 proteins in SMART's nrdb database.

Click on the following links for more information.