The domain within your query sequence starts at position 114 and ends at position 297; the E-value for the FBA domain shown below is 3.81e-104.

WQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWRVEELPGDNGVEFTQDDSVKKYF
ASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENED
VLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSV
WVEP

FBA

F-box associated region
FBA
SMART accession number:SM01198
Description: Members of this family are associated with F-box domains, hence the name FBA. This domain is probably involved in binding other proteins that will be targeted for ubiquitination. Q9UK22 is involved in binding to N-glycosylated proteins.
Interpro abstract (IPR007397):

Proteins containing this domain are associated with F-box domains (IPR001810), hence the name FBA. This domain is probably involved in binding other proteins that will be targeted for ubiquitination. Q9UK22 is involved in binding to N-glycosylated proteins.

Family alignment:
View or

There are 1891 FBA domains in 1854 proteins in SMART's nrdb database.

Click on the following links for more information.