The domain within your query sequence starts at position 1000 and ends at position 1040; the E-value for the FBOX domain shown below is 1.69e-2.

MHREVWMAVFSYLSHRDLCVCMRVCRTWNRWCCDKRLWTRI

FBOX

A Receptor for Ubiquitination Targets
FBOX
SMART accession number:SM00256
Description: -
Interpro abstract (IPR001810):

First identified in cyclin-F as a protein-protein interaction motif, the F-box is a conserved domain that is present in numerous proteins with a bipartite structure [(PUBMED:8706131)]. Through the F-box, these proteins are linked to the Skp1 protein and the core of SCFs (Skp1-cullin-F-box protein ligase) complexes. SCFs complexes constitute a new class of E3 ligases [(PUBMED:9346238)]. They function in combination with the E2 enzyme Cdc34 to ubiquitinate G1 cyclins, Cdk inhibitors and many other proteins, to mark them for degradation. The binding of the specific substrates by SCFs complexes is mediated by divergent protein-protein interaction motifs present in F-box proteins, like WD40 repeats, leucine rich repeats [(PUBMED:9529603), (PUBMED:10581972)] or ANK repeats.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 84937 FBOX domains in 82912 proteins in SMART's nrdb database.

Click on the following links for more information.