The domain within your query sequence starts at position 289 and ends at position 399; the E-value for the FDF domain shown below is 6.14e-35.

MKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEG
NADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPL

FDF

FDF
SMART accession number:SM01199
Description: The FDF domain, so called because of the conserved FDF at its N termini, is an entirely alpha-helical domain with multiple exposed hydrophilic loops. It is found at the C terminus of Scd6p-like SM domains. It is also found with other divergent Sm domains and in proteins such as Dcp3p and FLJ21128, where it is found N terminal to the YjeF-N domain, a novel Rossmann fold domain PMID 15257761.
Interpro abstract (IPR019050):

The FDF domain, so called because of the conserved FDF at its N termini, is an entirely alpha-helical domain with multiple exposed hydrophilic loops [ (PUBMED:15257761) ]. It is found at the C terminus of Scd6p-like SM domains [ (PUBMED:15257761) (PUBMED:15225602) ]. It is also found with other divergent Sm domains and in proteins such as Dcp3p and FLJ21128, where it is found N-terminal to the YjeF-N domain, a novel Rossmann fold domain [ (PUBMED:15257761) ].

Family alignment:
View or

There are 3917 FDF domains in 3915 proteins in SMART's nrdb database.

Click on the following links for more information.