The domain within your query sequence starts at position 135 and ends at position 206; the E-value for the FISNA domain shown below is 1.45e-22.

MYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEHPSKQEREHELLTIGRTKMRDS
PMSSLKLELLFE

FISNA

Fish-specific NACHT associated domain
FISNA
SMART accession number:SM01288
Description: This domain is frequently found associated with the NACHT domain (PFAM: PF05729) in fish and other vertebrates PMID:18039395.
Interpro abstract (IPR029495):

This domain is frequently found associated with the NACHT domain ( IPR007111 ) in fish and other vertebrates [ (PUBMED:18039395) ]. Proteins containing this domain include NACHT, LRR and PYD domains-containing protein 3/12 (NLRP3/12). In humans, NLRP3 (also known as PYPAF1) may function as an inducer of apoptosis [ (PUBMED:11786556) ]. NLRP12 is a non-inflammasome NLR (nucleotide-binding domain and leucine-rich repeat-containing receptors) that has been implicated in the regulation of Toll-like receptor-dependent nuclear factor-kappaB activation [ (PUBMED:21978668) ].

Family alignment:
View or

There are 5755 FISNA domains in 5693 proteins in SMART's nrdb database.

Click on the following links for more information.