The domain within your query sequence starts at position 128 and ends at position 262; the E-value for the FIST_C domain shown below is 2.61e-6.

ASNYLHRVVSTFSDMNIILAGGQVDNLSSLTCEKNPLDIDATGVVGLSFSGHRIQSATVL
LTEDVNDAKTVEAAMQRLKAANIPEQNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPS
VPLFGFFGNGEIGCD

FIST_C

FIST_C
SMART accession number:SM01204
Description: The FIST C domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids. PMID:17855421
Interpro abstract (IPR019494):

This entry represents a novel sensory domain, designated FIST_C (short for F-box and intracellular signal transduction, C-terminal), which is present in signal transduction proteins from bacteria, archaea and eukaryotes. The chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids [ (PUBMED:17855421) ].

Family alignment:
View or

There are 7371 FIST_C domains in 7366 proteins in SMART's nrdb database.

Click on the following links for more information.