The domain within your query sequence starts at position 4386 and ends at position 4990; the E-value for the FSA_C domain shown below is < 1e-12.

VNKSNKAASQQGTPWETLVVFAINLKQLNVQMNMSNVMGNTTWTTSGLKSQGRLSVGSNR
DREISMSVGLGRSQLDSKGGVVGGTIDVNALEMVAHISEHPNQQPNHKIQITMGSTESRV
DYMGSSILMGIFSNADLKLQDEWKVNLYNALDSSMTDKSEIFVHGDLKWDIFQVMISRST
TPDLIKIGMKLQEFFTQQFDTSKRALSTWGPVPYLPPKTMTNNLEKNSQEQLLDAAHHRH
WPGVLKVVSGCHISLFQVPLPEDGMQFGGSMSLHGNHMTLACFHGPNFRSKSWALFHLEE
PNIAFWTEAQKIWEDGSSDHSTYIVQTLDFHLGHNTMVTKPCGALESPMATITKITRRRH
ENPPHGVASVKEWFNYVTATRNEELNLLRNVDANNTENSTTVKNSSLLSGFRGGSSYNHE
TETIFALPRMQLEFKSIHVQEPQEPSLQDASLKPKVECSVVTEFTDHICVTMDAELIMFL
HDLVSAYLKEKEKAIFPPRILSTRPGQKCPLIIHDDSSSDRDREDSITYTTVDWRDFMCN
TWHLEPTLRLISWTGRKIDPVGVDYILQKLGFHHARTTIPKWLQRGVMDPLDKVLSVLIK
KLGTA

FSA_C

Fragile site-associated protein C-terminus
FSA_C
SMART accession number:SM01220
Description: This is the conserved C-terminal half of the protein KIAA1109 which is the fragile site-associated protein FSA (PUBMED:16545529). Genome-wide-association studies showed this protein linked to the susceptibility to coeliac disease (PUBMED:17558408). The protein may also be associated with polycystic kidney disease (PUBMED:16632497).
Interpro abstract (IPR018863):

This is the conserved C-terminal half of the protein KIAA1109, which is the fragile site-associated protein FSA [(PUBMED:16545529)]. Genome-wide-association studies showed this protein to linked to the susceptibility to coeliac disease [(PUBMED:17558408)]. The protein may also be associated with polycystic kidney disease [(PUBMED:16632497)].

Family alignment:
View or

There are 1204 FSA_C domains in 1202 proteins in SMART's nrdb database.

Click on the following links for more information.