The domain within your query sequence starts at position 3 and ends at position 180; the E-value for the FTCD_N domain shown below is 1.6e-120.

QLVECVPNFSEGNNQEVIDAISRAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVEGA
LHAARTASQLIDMSKHKGEHPRMGALDVCPFIPVRGVSMEECVLCAKAFGQRLAEELNVP
VYLYGEAAQTPSRQTLPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARK

FTCD_N

Formiminotransferase domain, N-terminal subdomain
FTCD_N
SMART accession number:SM01222
Description: The formiminotransferase (FT) domain of formiminotransferase- cyclodeaminase (FTCD) forms a homodimer, and each protomer comprises two subdomains. The N-terminal subdomain is made up of a six-stranded mixed beta-pleated sheet and five alpha helices, which are arranged on the external surface of the beta sheet. This, in turn, faces the beta-sheet of the C-terminal subdomain to form a double beta-sheet layer. The two subdomains are separated by a short linker sequence, which is not thought to be any more flexible than the remainder of the molecule. The substrate is predicted to form a number of contacts with residues found in both the N-terminal and C-terminal subdomains (PUBMED:10673422).
Interpro abstract (IPR012886):

The formiminotransferase (FT) domain of formiminotransferase-cyclodeaminase (FTCD) forms a homodimer, with each protomer being comprised of two subdomains. The formiminotransferase domain has an N-terminal subdomain that is made up of a six-stranded mixed beta-pleated sheet and five alpha helices, which are arranged on the external surface of the beta sheet. This, in turn, faces the beta-sheet of the C-terminal subdomain to form a double beta-sheet layer. The two subdomains are separated by a short linker sequence, which is not thought to be any more flexible than the remainder of the molecule. The substrate is predicted to form a number of contacts with residues found in both the N-terminal and C-terminal subdomains [ (PUBMED:10673422) ].

This entry represents the N-terminal subdomain of the formiminotransferase domain.

GO function:folic acid binding (GO:0005542), transferase activity (GO:0016740)
Family alignment:
View or

There are 3086 FTCD_N domains in 3083 proteins in SMART's nrdb database.

Click on the following links for more information.