The domain within your query sequence starts at position 727 and ends at position 792; the E-value for the FerA domain shown below is 3.1e-27.

LALKAQCSSEDVDALVAQLTDELLADCSQPLCDIHEIPSATHLDQYLLRLRTRHLSQIKE
AALALK

FerA

FerA
SMART accession number:SM01200
Description: This is central domain A in proteins of the Ferlin family. PMID: 15112237
Interpro abstract (IPR012560):

The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease [(PUBMED:20667140)].

This is central domain A in proteins of the Ferlin family [(PUBMED:15112237)].

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 1577 FerA domains in 1575 proteins in SMART's nrdb database.

Click on the following links for more information.