The domain within your query sequence starts at position 239 and ends at position 563; the E-value for the Frizzled domain shown below is 3.32e-218.

MFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVA
YIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPA
TIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGI
TSGFWIWSGKTLHSWRKFYTRLTNS

Frizzled

Frizzled/Smoothened family membrane region
Frizzled
SMART accession number:SM01330
Description: Frizzled is a family of G protein-coupled receptor proteins (PMID: 14977528) that serves as receptors in the Wnt signaling pathway and other signaling pathways. When activated, Frizzled leads to activation of Dishevelled in the cytosol.
Interpro abstract (IPR000539):

This domain is the membrane spanning region of frizzled and smoothened receptors. This membrane region is predicted to contain seven transmembrane alpha helices. Proteins related to Drosophila frizzled (P18537) are receptors for Wnt (mediating the beta-catenin signalling pathway) [(PUBMED:8717036)], but also the planar cell polarity (PCP) pathway and the Wnt/calcium pathway. The predominantly alpha-helical Cys-rich ligand-binding region (CRD) of Frizzled is both necessary and sufficient for Wnt binding [(PUBMED:15239825)]. The smoothened receptor mediates hedgehog signalling [(PUBMED:9811578)].

GO process:cell surface receptor signaling pathway (GO:0007166)
GO component:membrane (GO:0016020)
Family alignment:
View or

There are 5099 Frizzled domains in 5097 proteins in SMART's nrdb database.

Click on the following links for more information.