The domain within your query sequence starts at position 333 and ends at position 426; the E-value for the GARS_C domain shown below is 1.33e-44.

SAVTVVMASKGYPGAYTKGVEITGFPEAQALGLQVFHAGTALKDGKVVTSGGRVLTVTAV
QENLMSALAEARKGLAALKFEGAIYRKDIGFRAV

GARS_C

Phosphoribosylglycinamide synthetase, C domain
GARS_C
SMART accession number:SM01210
Description: Phosphoribosylglycinamide synthetase catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by Phosphoribosylglycinamide synthetase is the ATP- dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide. This domain is related to the C-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (Pfam PF02787).
Interpro abstract (IPR020560):

Phosphoribosylglycinamide synthetase ( EC 6.3.4.13 ) (GARS) (phosphoribosylamine glycine ligase) [ (PUBMED:2687276) ] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide: ATP + 5-phosphoribosylamine + glycine = ADP + P i + 5'-phosphoribosylglycinamide In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5,7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) [ (PUBMED:3097325) ]. In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS and with phosphoribosylglycinamide formyltransferase (GART), forming GARS-AIRS-GART [ (PUBMED:2147474) ].

This entry represents the C-domain, which is related to the C-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase ( IPR005480 ).

GO process:purine nucleobase biosynthetic process (GO:0009113)
GO function:phosphoribosylamine-glycine ligase activity (GO:0004637)
Family alignment:
View or

There are 23116 GARS_C domains in 23108 proteins in SMART's nrdb database.

Click on the following links for more information.