The domain within your query sequence starts at position 5204 and ends at position 5282; the E-value for the GAS2 domain shown below is 1.59e-53.

DKIEDEVTRQVAQCKCAKRFQVEQIGENKYRVTLGRQFGDSQQLRLVRILRSTVMVRVGG
GWMALDEFLVKNDPCRARG

GAS2

Growth-Arrest-Specific Protein 2 Domain
GAS2
SMART accession number:SM00243
Description: GROWTH-ARREST-SPECIFIC PROTEIN 2 Domain
Interpro abstract (IPR003108):

The GAR (Gas2-related) domain is common in plakin family members and Gas2 family members. It comprises around 57 amino acids and has been shown to bind to microtubules [(PUBMED:20335501), (PUBMED:11112700), (PUBMED:11854008)].

GO function:microtubule binding (GO:0008017)
Family alignment:
View or

There are 2847 GAS2 domains in 2844 proteins in SMART's nrdb database.

Click on the following links for more information.