The domain within your query sequence starts at position 264 and ends at position 294; the E-value for the GIT domain shown below is 1.01e-10.

AKKKLQALSNRLFEELAMDVYDEVDRRENDA

GIT

Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins
GIT
SMART accession number:SM00555
Description: Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins, and in yeast Spa2p and Sph1p (CPP; unpublished results). In p95-APP1 the N-terminal GIT motif might be involved in binding PIX.
Interpro abstract (IPR013724):

This entry represents the Spa2 homology domain (SHD) domain found in the yeast Spa2/Sph1 protein and the mammalian GIT proteins.

Budding yeast Spa2 is a component of the polarisome that functions in actin cytoskeletal organisation during polarized growth [ (PUBMED:12361575) ]. Its paralogue, Sph1, is involved in shmoo formation and bipolar bud site selection [ (PUBMED:9443897) ].

GIT is a GTPase-activating protein for the ADP ribosylation factor family. It may serve as a scaffold to bring together molecules to form signaling modules controlling vesicle trafficking, adhesion and cytoskeletal organisation [ (PUBMED:11896197) ]. Mutations in the Spa2 homology domain (SHD) domain of GIT1 described here interfere with the association of GIT1 with Piccolo, beta-PIX, and focal adhesion kinase [ (PUBMED:12473661) ].

Family alignment:
View or

There are 3024 GIT domains in 1498 proteins in SMART's nrdb database.

Click on the following links for more information.