The domain within your query sequence starts at position 198 and ends at position 322; the E-value for the Gal-bind_lectin domain shown below is 1.33e-65.
IPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQE ERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQL THVQT
Gal-bind_lectinGalactoside-binding lectin |
---|
SMART accession number: | SM00908 |
---|---|
Description: | Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. Galectins (previously S-lectins) bind exclusively beta-galactosides like lactose. They do not require metal ions for activity. Galectins are found predominantly, but not exclusively in mammals (PUBMED:8124704). Their function is unclear. They are developmentally regulated and may be involved in differentiation, cellular regulation and tissue construction. |
Family alignment: |
There are 10779 Gal-bind_lectin domains in 7909 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing Gal-bind_lectin domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with Gal-bind_lectin domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing Gal-bind_lectin domain in the selected taxonomic class.
- Cellular role (predicted cellular role)
-
Cellular role: metabolism
- Structure (3D structures containing this domain)
3D Structures of Gal-bind_lectin domains in PDB
PDB code Main view Title 1a3k X-RAY CRYSTAL STRUCTURE OF THE HUMAN GALECTIN-3 CARBOHYDRATE RECOGNITION DOMAIN (CRD) AT 2.1 ANGSTROM RESOLUTION 1a78 COMPLEX OF TOAD OVARY GALECTIN WITH THIO-DIGALACTOSE 1bkz CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 1c1f LIGAND-FREE CONGERIN I 1c1l LACTOSE-LIGANDED CONGERIN I 1g86 CHARCOT-LEYDEN CRYSTAL PROTEIN/N-ETHYLMALEIMIDE COMPLEX 1gan COMPLEX OF TOAD OVARY GALECTIN WITH N-ACETYLGALACTOSE 1gzw X-RAY CRYSTAL STRUCTURE OF HUMAN GALECTIN-1 1hdk Charcot-Leyden Crystal Protein - pCMBS Complex 1hlc X-RAY CRYSTAL STRUCTURE OF THE HUMAN DIMERIC S-LAC LECTIN, L-14-II, IN COMPLEX WITH LACTOSE AT 2.9 ANGSTROMS RESOLUTION 1is3 LACTOSE AND MES-LIGANDED CONGERIN II 1is4 LACTOSE-LIGANDED CONGERIN II 1is5 Ligand free Congerin II 1is6 MES-Liganded Congerin II 1kjl High Resolution X-Ray Structure of Human Galectin-3 in complex with LacNAc 1kjr Crystal Structure of the human galectin-3 CRD in complex with a 3'-derivative of N-Acetyllactosamine 1lcl CHARCOT-LEYDEN CRYSTAL PROTEIN 1qkq CHARCOT-LEYDEN CRYSTAL PROTEIN - MANNOSE COMPLEX 1qmj CG-16, a homodimeric agglutinin from chicken liver 1sla X-RAY CRYSTALLOGRAPHY REVEALS CROSSLINKING OF MAMMALIAN LECTIN (GALECTIN-1) BY BIANTENNARY COMPLEX TYPE SACCHARIDES 1slb X-RAY CRYSTALLOGRAPHY REVEALS CROSSLINKING OF MAMMALIAN LECTIN (GALECTIN-1) BY BIANTENNARY COMPLEX TYPE SACCHARIDES 1slc X-RAY CRYSTALLOGRAPHY REVEALS CROSSLINKING OF MAMMALIAN LECTIN (GALECTIN-1) BY BIANTENNARY COMPLEX TYPE SACCHARIDES 1slt STRUCTURE OF S-LECTIN, A DEVELOPMENTALLY REGULATED VERTEBRATE BETA-GALACTOSIDE BINDING PROTEIN 1ul9 CGL2 ligandfree 1ulc CGL2 in complex with lactose 1uld CGL2 in complex with blood group H type II 1ule CGL2 in complex with linear B2 trisaccharide 1ulf CGL2 in complex with Blood Group A tetrasaccharide 1ulg CGL2 in complex with Thomsen-Friedenreich antigen 1w6m X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 COMPLEXED WITH GALACTOSE 1w6n X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 1w6o X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 COMPLEXED WITH LACTOSE 1w6p X-RAY CRYSTAL STRUCTURE OF C2S HUMAN GALECTIN-1 COMPLEXED WITH N- Acetyl-LACTOSAMINE 1w6q X-RAY CRYSTAL STRUCTURE OF R111H HUMAN GALECTIN-1 1wlc Congerin II Y16S/T88I double mutant 1wld Congerin II T88I single mutant 1wlw Congerin II Y16S single mutant 1x50 Solution structure of the C-terminal gal-bind lectin domain from human galectin-4 2d6k Crystal structure of mouse galectin-9 N-terminal CRD (crystal form 1) 2d6l Crystal structure of mouse galectin-9 N-terminal CRD (crystal form 2) 2d6m Crystal structure of mouse galectin-9 N-terminal CRD in complex with lactose 2d6n Crystal structure of mouse galectin-9 N-terminal CRD in complex with N-acetyllactosamine 2d6o Crystal structure of mouse galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer 2d6p Crystal structure of mouse galectin-9 N-terminal CRD in complex with T-antigen 2dyc Crystal structure of the N-terminal domain of mouse galectin-4 2eak Crystal structure of human galectin-9 N-terminal CRD in complex with lactose 2eal Crystal structure of human galectin-9 N-terminal CRD in complex with Forssman pentasaccharide 2gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH GALACTOSE 2jj6 Crystal structure of the putative carbohydrate recognition domain of the human galectin-related protein 2km2 Galectin-1 dimer 2nmn Crystal structure of human galectin-3 carbohydrate-recognising domain at 2.45 angstrom resolution 2nmo Crystal structure of human galectin-3 carbohydrate-recognition domain at 1.35 angstrom resolution 2nn8 Crystal structure of human galectin-3 carbohydrate-recognition domain with lactose bound, at 1.35 angstrom resolution 2wkk Identification of the glycan target of the nematotoxic fungal galectin CGL2 in Caenorhabditis elegans 2wsu Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre 2wsv Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with lactose 2wt0 Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with N-acetyl-lactosamine 2wt1 Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with lacto-N-neo-tetraose 2wt2 Galectin domain of porcine adenovirus type 4 NADC-1 isolate fibre complexed with tri(N-acetyl-lactosamine) 2xg3 Human galectin-3 in complex with a benzamido-N-acetyllactoseamine inhibitor 2ymz Crystal structure of chicken Galectin 2 2yro Solution structure of the C-terminal Gal-bind lectin protein from Human Galectin-8 2yv8 Crystal structure of N-terminal domain of human galectin-8 2yxs Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose 2yy1 Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine 2zhk Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 1) 2zhl Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 2) 2zhm Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine trimer (crystal 1) 2zhn Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine trimer (crystal 2) 2zkn X-ray structure of mutant galectin-1/lactose complex 3ajy Crystal Structure of Ancestral Congerin Con-anc 3ajz Crystal Structure of Ancestral Congerin Con-anc 3ak0 Crystal Structure of Ancestral Congerin Con-anc'-N28K 3ap4 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose 3ap5 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain 3ap6 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose 3'-sulfate 3ap7 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with lactose sialic acid 3ap9 Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with Lacto-N-fucopentaose III 3apb Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with iodide 3aya Crystal structure of galectin-3 CRD domian complexed with Thomsen-Friedenreich antigen 3ayc Crystal structure of galectin-3 CRD domian complexed with GM1 pentasaccharide 3ayd Crystal structure of galectin-3 CRD domian complexed with TFN 3aye Crystal structure of galectin-3 CRD domian complexed with lactose 3b9c Crystal Structure of Human GRP CRD 3dui Crystal structure of the oxidized CG-1B: an adhesion/growth-regulatory lectin from chicken 3gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH GALACTOSAMINE 3i8t N-terminal CRD1 domain of mouse Galectin-4 in complex with lactose 3lsd N-Domain of human adhesion/growth-regulatory galectin-9 3lse N-Domain of human adhesion/growth-regulatory galectin-9 in complex with lactose 3m2m Rat galectin-1 complex with lactose 3nv1 Crystal structure of human galectin-9 C-terminal CRD 3nv2 Crystal structure of human galectin-9 C-terminal CRD in complex with N-acetyllactosamine 3nv3 Crystal structure of human galectin-9 C-terminal CRD in complex with biantennary oligosaccharide 3nv4 Crystal structure of human galectin-9 C-terminal CRD in complex with Sialyllactose 3ojb Crystal structure of C-terminal domain of human galectin-8 3oy8 Crystal structure of human galectin-1 in complex with lactobionic acid 3oyw Crystal structure of human galectin-1 in complex with thiodigalactoside 3t1l Crystal structure of human Galectin-3 in complex with methyl 2-O-acetyl-3-O-toluoyl-beta-D-talopyranoside 3t1m Crystal structure of human galectin-3 carbohydrate recognition domain in complex with methyl 3-deoxy-2-O-toluoyl-3-N-toluoyl-beta-D-talopyranoside 3t2t Crystal structure of human galectin-1 in complex with methyl 2-O-acetyl-3-O-toluoyl-beta-D-talopyranoside 3vkl Protease-resistant mutant form of human Galectin-8 in complex with two lactose molecules 3vkm Protease-resistant mutant form of Human Galectin-8 in complex with sialyllactose and lactose 3vkn Galectin-8 N-terminal domain in free form 3vko Galectin-8 N-terminal domain in complex with sialyllactosamine 3vv1 Crystal Structure of Caenorhabditis elegans galectin LEC-6 3w58 Crystal structure of Galectin-1 in the lactose-unbound state(P21) 3w59 Crystal structure of Galectin-1 in the lactose-unbound state(P212121) 3wlu 3WLU 3wuc 3WUC 3wud 3WUD 3wv6 3WV6 3zsj Crystal structure of Human Galectin-3 CRD in complex with Lactose at 0.86 angstrom resolution 3zsk Crystal structure of Human Galectin-3 CRD with glycerol bound at 0.90 angstrom resolution 3zsl Crystal structure of Apo Human Galectin-3 CRD at 1.08 angstrom resolution, at cryogenic temperature 3zsm Crystal structure of Apo Human Galectin-3 CRD at 1.25 angstrom resolution, at room temperature 3zxe Crystal structure of Human Galectin-7 in complex with a galactose- benzylphosphate inhibitor 3zxf High resolution structure of Human Galectin-7 4agg Structure of a tetrameric galectin from Cinachyrella sp. (Ball sponge) 4agr Structure of a tetrameric galectin from Cinachyrella sp. (Ball sponge) 4agv Structure of a tetrameric galectin from Cinachyrella sp. (Ball sponge) 4bli Galectin-3c in complex with Bisamido-thiogalactoside derivate 1 4blj Galectin-3c in complex with Bisamido-thiogalactoside derivate 2 4bm8 Galectin-3c in complex with Bisamido-thiogalactoside derivate 3 4bmb Crystal structure of the N terminal domain of human Galectin 8 4bme Crystal structure of the N terminal domain of human Galectin 8, F19Y mutant 4fqz Crystal structure of a protease-resistant mutant form of human galectin-8 4ga9 Crystal Structure of Rat Galectin-1 in Complex with Lactose 4gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH LACTOSE 4gxl The crystal structure of Galectin-8 C-CRD in complex with NDP52 4han Crystal structure of Galectin 8 with NDP52 peptide 4hl0 Crystal structure of full-length Toxascaris leonina galectin 4jc1 Galectin-3 carbohydrate recognition domain in complex with thiodigalactoside 4jck Galectin-3 carbohydrate recognition domain in complex with thioditaloside 4lbj Crystal structure of Human galectin-3 CRD K176L mutant in complex with LNT 4lbk Crystal structure of Human galectin-3 CRD K176L mutant in complex with LNnT 4lbl Crystal structure of Human galectin-3 CRD K176L mutant in complex with a-GM3 4lbm Crystal structure of Human galectin-3 CRD in complex with LNT 4lbn Crystal structure of Human galectin-3 CRD in complex with LNnT 4lbo Crystal structure of Human galectin-3 CRD in complex with a-GM3 4lbq 4LBQ 4no4 4NO4 4q1p 4Q1P 4q1r 4Q1R 4q26 4Q26 4q27 4Q27 4q2f 4Q2F 4r9a 4R9A 4r9b 4R9B 4r9c 4R9C 4r9d 4R9D 4rl7 4RL7 4uw3 4UW3 4uw4 4UW4 4uw5 4UW5 4uw6 4UW6 4wvv 4WVV 4wvw 4WVW 4xbl 4XBL 4xbn 4XBN 4xbq 4XBQ 4xzp 4XZP 4y1u 4Y1U 4y1v 4Y1V 4y1x 4Y1X 4y1y 4Y1Y 4y1z 4Y1Z 4y20 4Y20 4y22 4Y22 4y24 4Y24 4y26 4Y26 4ylz 4YLZ 4ym0 4YM0 4ym1 4YM1 4ym2 4YM2 4ym3 4YM3 5cbl 5CBL 5dg1 5DG1 5dg2 5DG2 5duu 5DUU 5duv 5DUV 5duw 5DUW 5dux 5DUX 5e88 5E88 5e89 5E89 5e8a 5E8A 5ews 5EWS 5exo 5EXO 5gal CRYSTAL STRUCTURE OF HUMAN GALECTIN-7 IN COMPLEX WITH N-ACETYLLACTOSAMINE 5glt 5GLT 5glu 5GLU 5glv 5GLV 5glw 5GLW 5glz 5GLZ 5gm0 5GM0 5h9p 5H9P 5h9q 5H9Q 5h9r 5H9R 5h9s 5H9S 5it6 5IT6 - Links (links to other resources describing this domain)
-
PFAM Gal-bind_lectin