The domain within your query sequence starts at position 1121 and ends at position 1171; the E-value for the GluR_Homer-bdg domain shown below is 1.42e-24.

ALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL

GluR_Homer-bdg

GluR_Homer-bdg
SMART accession number:SM01229
Description: This is the proline-rich region of metabotropic glutamate receptor proteins that binds Homer-related synaptic proteins. The Homer proteins form a physical tether linking mGluRs with the inositol trisphosphate receptors (IP3R) that appears to be due to the proline-rich "Homer ligand" (PPXXFr). Activation of PI turnover triggers intracellular calcium release (PMID:9808459). MGluR function is altered in the mouse model of human Fragile X syndrome mental retardation, a disorder caused by loss of function mutations in the Fragile X mental retardation gene Fmr1. Homer 3 (and to a lesser extent Homer 1b/c) has been shown to form a multimeric complex with mGlu1a and the IP3 receptor, indicating that Homers may play a role in the localisation of receptors to their signalling partners (PMID:18184796)
Interpro abstract (IPR019588):

This entry represents the proline-rich region of metabotropic glutamate receptor proteins that bind Homer-related synaptic proteins.

Metabotropic glutamate receptors function as receptors for glutamate. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.

The Homer proteins form a physical tether linking mGluRs with the inositol trisphosphate receptors (IP3R) that appears to be due to the proline-rich Homer ligand (PPXXFr). Activation of PI turnover triggers intracellular calcium release [(PUBMED:9808459)]. Metabotropic glutamate receptor (MGluR) function is altered in the mouse model of human Fragile X syndrome mental retardation, a disorder caused by loss of function mutations in the Fragile X mental retardation gene Fmr1. Homer 3 (and to a lesser extent Homer 1b/c) has been shown to form a multimeric complex with mGlu1a and the IP3 receptor, indicating that Homers may play a role in the localisation of receptors to their signalling partners [(PUBMED:18184796)].

Family alignment:
View or

There are 778 GluR_Homer-bdg domains in 778 proteins in SMART's nrdb database.

Click on the following links for more information.