The domain within your query sequence starts at position 682 and ends at position 728; the E-value for the Grip domain shown below is 5.68e-18.

REINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKET

Grip

golgin-97, RanBP2alpha,Imh1p and p230/golgin-245
Grip
SMART accession number:SM00755
Description: -
Interpro abstract (IPR000237): The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [(PUBMED:10209120), (PUBMED:10209123), (PUBMED:10209125)] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi [(PUBMED:14580338)]. The GRIP domain contains a completely conserved tyrosine residue.
Family alignment:
View or

There are 2004 Grip domains in 2002 proteins in SMART's nrdb database.

Click on the following links for more information.