The domain within your query sequence starts at position 3 and ends at position 123; the E-value for the H2A domain shown below is 8.07e-81.

GRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE
S

H2A

Histone 2A
H2A
SMART accession number:SM00414
Description: -
Interpro abstract (IPR002119): Histone H2A is a small, highly conserved nuclear protein that, together with two molecules each of histones H2B, H3 and H4, forms the eukaryotic nucleosome core [(PUBMED:8121801)]; the nucleosome octamer winds ~146 DNA base-pairs. In the mouse, histone H2A can be replaced by histone H2A-like 1 [(PUBMED:17261847)].
GO component:nucleosome (GO:0000786), nucleus (GO:0005634)
GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 8028 H2A domains in 7999 proteins in SMART's nrdb database.

Click on the following links for more information.