The domain within your query sequence starts at position 923 and ends at position 1013; the E-value for the HA2 domain shown below is 3.22e-32.
NSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVP AIFYRPKGREEESDQIREKFAVPESDHLTYL
HA2Helicase associated domain (HA2) Add an annotation |
---|
SMART accession number: | SM00847 |
---|---|
Description: | This presumed domain is about 90 amino acid residues in length. It is found is a diverse set of RNA helicases. Its function is unknown, however it seems likely to be involved in nucleic acid binding. |
Interpro abstract (IPR007502): | This presumed domain is about 90 amino acid residues in length. It is found as a diverse set of RNA helicases. Its function is unknown, however it seems likely to be involved in nucleic acid binding. |
GO function: | helicase activity (GO:0004386) |
Family alignment: |
There are 38456 HA2 domains in 38427 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)