The domain within your query sequence starts at position 240 and ends at position 364; the E-value for the HATPase_c domain shown below is 9.32e-14.

YVPSHLYHMLFELFKNAMRATVESHESSLTLPPIKIMVALGEEDLSIKMSDRGGGVPLRK
IERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIY
LKALS

HATPase_c

Histidine kinase-like ATPases
HATPase_c
SMART accession number:SM00387
Description: Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
Interpro abstract (IPR003594):

This domain is found in several ATP-binding proteins, including: histidine kinase [(PUBMED:15157101)], DNA gyrase B, topoisomerases [(PUBMED:15105144)], heat shock protein HSP90 [(PUBMED:15292259), (PUBMED:14718169), (PUBMED:15217611)], phytochrome-like ATPases and DNA mismatch repair proteins. The fold of this domain consists of two layers, alpha/beta, which contains an 8-stranded mixed beta-sheet.

Family alignment:
View or

There are 925732 HATPase_c domains in 922402 proteins in SMART's nrdb database.

Click on the following links for more information.