The domain within your query sequence starts at position 112 and ends at position 276; the E-value for the HDc domain shown below is 5.19e-7.

NPYHNLVHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTR
SDVAILYNDRSVLENHHVSAAYRLMQEEEMNILVNLSKDDWRDLRNLVIEMVLATDMSGH
FQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKTWKLHYRW

HDc

Metal dependent phosphohydrolases with conserved 'HD' motif.
HDc
SMART accession number:SM00471
Description: Includes eukaryotic cyclic nucleotide phosphodiesterases (PDEc). This profile/HMM does not detect HD homologues in bacterial glycine aminoacyl-tRNA synthetases (beta subunit).
Interpro abstract (IPR003607): This entry represents the HD domain, which is is found in a superfamily of enzymes with a predicted or known phosphohydrolase activity. It also represents a related phosphodiesterase (PDEase) domain that is found in eukaryotic 3',5'-cGMP phosphodiesterase (EC 3.1.4.17), which is located in photoreceptor outer segments and it is light activated, playing a pivotal role in signal transduction.
Family alignment:
View or

There are 209505 HDc domains in 208022 proteins in SMART's nrdb database.

Click on the following links for more information.