The domain within your query sequence starts at position 56 and ends at position 315; the E-value for the HTTM domain shown below is 1.34e-131.

NKPTDPANLAVFRFLFAFLMLLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWM
YLVYTIMFLGALGMMLGLCYRLSCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMD
ANHYWSVDGLLNARKKNAHVPLWNYTVLRGQIFIVYFIAGVKKLDADWVGGYSMEHLSRH
WLFSPFKLVLSEELTSLLVVHWCGLLLDLSAGFLLFFDASRPVGLFFVSYFHCMNSQLFS
IGMFPYVMLASSPLFCSAEW

HTTM

Horizontally Transferred TransMembrane Domain

• SMART accession number: SM00752
• Description: Sequence analysis of vitamin K dependent gamma-carboxylases (VKGC) revealed the presence of a novel domain, HTTM (Horizontally Transferred TransMembrane) in its N-terminus. In contrast to most known domains, HTTM contains four transmembrane regions. Its occurrence in eukaryotes, bacteria and archaea is more likely caused by horizontal gene transfer than by early invention. The conservation of VKGC catalytic sites indicates an enzymatic function also for the other family members.
• Interpro abstract (IPR011020):

  Sequence analysis of vitamin K dependent gamma-carboxylases (VKGC) revealed the presence of a novel domain, HTTM (Horizontally Transferred TransMembrane). In contrast to most known domains, HTTM contains four transmembrane regions. Its occurrence in eukaryotes, bacteria and archaea is more likely caused by horizontal gene transfer than by early invention. The conservation of VKGC catalytic sites indicates an enzymatic function also for the other family members.

There are 2048 HTTM domains in 2048 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Schultz J
• HTTM, a horizontally transferred transmembrane domain.
• Trends Biochem Sci. 2004; 29: 4-7

Sequence analysis of vitamin K-dependent gamma-carboxylases (VKGC) has revealed the presence of a novel domain, HTTM (for horizontally transferred transmembrane) in its N terminus. In contrast to most known domains, HTTM contains four transmembrane regions. Its occurrence in eukaryotes, bacteria and archaea is probably caused by horizontal gene transfer rather than by early evolution. The conservation of VKGC catalytic sites also indicates an enzymatic function for the other family members.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
100.00	map00100	Biosynthesis of steroids

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with HTTM domain which could be assigned to a KEGG orthologous group, and not all proteins containing HTTM domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Links (links to other resources describing this domain)

• INTERPRO: IPR011020