The domain within your query sequence starts at position 847 and ends at position 880; the E-value for the HhH2 domain shown below is 2.94e-11.

RNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEF

HhH2

Helix-hairpin-helix class 2 (Pol1 family) motifs
HhH2
SMART accession number:SM00279
Description: -
Interpro abstract (IPR008918):

The helix-hairpin-helix (HhH) motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins. The HhH motif is similar to, but distinct from, the helix-turn-helix (HtH) and the helix-loop-helix (HLH) motifs. All three motifs have two helices (H1 and H2) connected by a short turn. DNA-binding proteins with a HhH structural motif are involved in non-sequence-specific DNA binding that occurs via the formation of hydrogen bonds between protein backbone nitrogens and DNA phosphate groups. These HhH motifs are observed in DNA repair enzymes and in DNA polymerases. By contrast, proteins with a HtH motif bind DNA in a sequence-specific manner through the binding of H2 with the major groove; these proteins are primarily gene regulatory proteins. DNA-binding proteins with the HLH structural motif are transcriptional regulatory proteins and are principally related to a wide array of developmental processes [(PUBMED:15356290)].

Examples of proteins that contain a HhH motif include the 5'-exonuclease domains of prokaryotic DNA polymerases [(PUBMED:10666572)], the eukaryotic/prokaryotic RAD2 family of 5'-3' exonucleases such as T4 RNase H and T5 [(PUBMED:8674116), (PUBMED:9874768)], eukaryotic 5' endonucleases such as FEN-1 (Flap) [(PUBMED:9699635)], and some viral exonucleases.

GO function:catalytic activity (GO:0003824), DNA binding (GO:0003677)
Family alignment:
View or

There are 35926 HhH2 domains in 35913 proteins in SMART's nrdb database.

Click on the following links for more information.