The domain within your query sequence starts at position 197 and ends at position 304; the E-value for the HintN domain shown below is 1.29e-25.

GGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVLLFLDRDLQRRASFVAV
ETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPG

HintN

Hint (Hedgehog/Intein) domain N-terminal region
HintN
SMART accession number:SM00306
Description: Hedgehog/Intein domain, N-terminal region. Domain has been split to accommodate large insertions of endonucleases.
Interpro abstract (IPR003587):

Hedgehog proteins are a family of secreted signal molecules required for embryonic cell differentiation. They are synthesised as inactive precursors with an N-terminal signalling domain linked to a C-terminal autoprocessing domain. The three-dimensional structure of the autolytic domain of the hedgehog protein of shows similarity with the beta-strand core of intein splicing domains. It has hence been termed the hint (Hedgehog/Intein) domain [ (PUBMED:9489693) ].

This entry represents the N-terminal region of the hint domain.

Family alignment:
View or

There are 10871 HintN domains in 9985 proteins in SMART's nrdb database.

Click on the following links for more information.