The domain within your query sequence starts at position 197 and ends at position 304; the E-value for the HintN domain shown below is 1.29e-25.
GGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVLLFLDRDLQRRASFVAV ETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPG
HintNHint (Hedgehog/Intein) domain N-terminal region |
---|
SMART accession number: | SM00306 |
---|---|
Description: | Hedgehog/Intein domain, N-terminal region. Domain has been split to accommodate large insertions of endonucleases. |
Interpro abstract (IPR003587): | Hedgehog proteins are a family of secreted signal molecules required for embryonic cell differentiation. They are synthesised as inactive precursors with an N-terminal signalling domain linked to a C-terminal autoprocessing domain. The three-dimensional structure of the autolytic domain of the hedgehog protein of shows similarity with the beta-strand core of intein splicing domains. It has hence been termed the hint (Hedgehog/Intein) domain [ (PUBMED:9489693) ]. This entry represents the N-terminal region of the hint domain. |
Family alignment: |
There are 10871 HintN domains in 9985 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Disease (disease genes where sequence variants are found in this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)