The domain within your query sequence starts at position 94 and ends at position 176; the E-value for the IG domain shown below is 5.75e-4.
GPATLIFEGDTLVLHCRAWQDWPLTQVIFYREGSALGPPGPKSEFSITMVQKSDGGHYHC SGIFRSPGPGSREAASPVAITVQ
IGImmunoglobulin |
![]() |
|---|
| SMART accession number: | SM00409 |
|---|---|
| Description: | |
| Interpro abstract (IPR003599): | The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106), C1-set (constant-1; IPR003597), C2-set (constant-2; IPR008424) and I-set (intermediate; IPR013098) [(PUBMED:9417933)]. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [(PUBMED:15327963), (PUBMED:11377196)]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [(PUBMED:10698639)]. This subfamily includes:
|
| Family alignment: |
There are 30472 IG domains in 15399 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Click on
to expand nodes. To display all proteins with a IG domain in a specific node, click on it.This tree shows only several representative species. The complete taxonomic breakdown of all proteins with IG domain is also avaliable.
Useful shortcuts: Expand all nodes or Collapse tree
Go to specific node: Anopheles gambiae, Caenorhabditis elegans, Drosophila melanogaster, Homo sapiens, Mus musculus, Rattus norvegicus, Takifugu rubripes - Disease (disease genes where sequence variants are found in this domain)
-
SwissProt sequences and OMIM curated human diseases associated with missense mutations within the IG domain.
Protein Disease Fibroblast growth factor receptor 2 (P21802) (SMART) OMIM:176943: Crouzon syndrome
OMIM:123500: Jackson-Weiss syndrome
OMIM:123150: Beare-Stevenson cutis gyrata syndrome
OMIM:123790: Pfeiffer syndrome
OMIM:101600: Apert syndrome
OMIM:101200: Saethre-Chotzen syndromeMyelin protein P0 (P25189) (SMART) OMIM:159440: Charcot-Marie-Tooth neuropathy-1B
OMIM:118200: Dejerine-Sottas disease, myelin P-zero-related
OMIM:145900: Hypomyelination, congenitalMyosin-binding protein C, cardiac-type (Q14896) (SMART) OMIM:600958: Cardiomyopathy, familial hypertrophic, 4
OMIM:115197:Netrin receptor DCC (P43146) (SMART) OMIM:120470: Colorectal cancer Intercellular adhesion molecule 1 (P05362) (SMART) OMIM:147840: {Malaria, cerebral, susceptibility to} Low affinity immunoglobulin gamma Fc region receptor III-A (P08637) (SMART) OMIM:146740: {Lupus erythematosus, systemic, susceptibility}
OMIM:152700: Neutropenia, alloimmune neonatal ; {Viral infections, recurrent}Poliovirus receptor (P15151) (SMART) OMIM:173850: {Polio, susceptibility to} T-cell surface glycoprotein CD4 (P01730) (SMART) OMIM:186940: {Lupus erythematosus, susceptibility to} High affinity nerve growth factor receptor (P04629) (SMART) OMIM:191315: Insensitivity to pain, congenital, with anhidrosis
OMIM:256800: Medullary thyroid carcinoma, familial
OMIM:155240:Low affinity immunoglobulin gamma Fc region receptor II-a (P12318) (SMART) OMIM:146790: {Lupus nephritis, susceptibility to} Neural cell adhesion molecule L1 (P32004) (SMART) OMIM:308840: Hydrocephalus due to aqueductal stenosis
OMIM:307000: MASA syndrome
OMIM:303350: Spastic paraplegia
OMIM:312900: - Metabolism (metabolic pathways involving proteins which contain this domain)
-

Click the image to view the interactive version of the map in iPath% proteins involved KEGG pathway ID Description 22.54 map04514 Cell adhesion molecules (CAMs) 9.23 map04060 Cytokine-cytokine receptor interaction 8.07 map04640 Hematopoietic cell lineage 7.72 map04360 Axon guidance 5.50 map04662 B cell receptor signaling pathway 4.79 map04650 Natural killer cell mediated cytotoxicity 4.44 map04670 Leukocyte transendothelial migration 4.35 map04510 Focal adhesion 3.11 map04520 Adherens junction 2.84 map04010 MAPK signaling pathway 2.66 map04660 T cell receptor signaling pathway 2.40 map04810 Regulation of actin cytoskeleton 2.31 map04612 Antigen processing and presentation 2.04 map04020 Calcium signaling pathway 1.77 map05120 Epithelial cell signaling in Helicobacter pylori infection 1.69 map05210 Colorectal cancer 1.69 map04210 Apoptosis 1.33 map05215 Prostate cancer 1.33 map05221 Acute myeloid leukemia 1.33 map05218 Melanoma 1.24 map05214 Glioma 1.24 map04540 Gap junction 0.98 map04940 Type I diabetes mellitus 0.89 map04916 Melanogenesis 0.80 map04370 VEGF signaling pathway 0.80 map04620 Toll-like receptor signaling pathway 0.62 map04664 Fc epsilon RI signaling pathway 0.53 map05216 Thyroid cancer 0.44
map00530Aminosugars metabolism 0.27 map05219 Bladder cancer 0.27 map04530 Tight junction 0.27 map04910 Insulin signaling pathway 0.18 map04512 ECM-receptor interaction 0.09
map00940Phenylpropanoid biosynthesis 0.09
map00680Methane metabolism 0.09
map00360Phenylalanine metabolism 0.09
map00500Starch and sucrose metabolism This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with IG domain which could be assigned to a KEGG orthologous group, and not all proteins containing IG domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of IG domains in PDB
PDB code Main view Title 1a64 
Engineering a misfolded form of rat cd2 1a7b 
Engineering a misfolded form of cd2 1ac6 
Crystal structure of a variable domain mutant of a t-cell receptor alpha chain 1b6u 
Crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles 1bd2 
Complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201 1bqh 
Murine cd8aa ectodomain fragment in complex with h-2kb/vsv8 1bqs 
The crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1) 1ccz 
Crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution 1cdc 
Cd2, n-terminal domain (1-99), truncated form 1ci5 
Glycan-free mutant adhesion domain of human cd58 (lfa-3) 1cid 
Crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains 1dqt 
The crystal structure of murine ctla4 (cd152) 1dr9 
Crystal structure of a soluble form of b7-1 (cd80) 1e4j 
Crystal structure of the soluble human fc-gamma receptor iii 1e4k 
Crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex 1eaj 
Dimeric structure of the coxsackie virus and adenovirus receptor d1 domain at 1.35 angstrom resolution 1efx 
Structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3 1f5w 
Dimeric structure of the coxsackie virus and adenovirus receptor d1 domain 1fcg 
Ectodomain of human fc gamma receptor, fcgriia 1flt 
Vegf in complex with domain 2 of the flt-1 receptor 1fnl 
Crystal structure of the extracellular domain of a human fcgriii 1fo0 
Murine alloreactive scfv tcr-peptide-mhc class i molecule complex 1fyt 
Crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1 1g0x 
Crystal structure of the ligand binding domain of lir-1 (ilt2) 1g0y 
Il-1 receptor type 1 complexed with antagonist peptide af10847 1g1c 
I1 domain from titin 1gsm 
A reassessment of the madcam-1 structure and its role in integrin recognition. 1gxe 
Central domain of cardiac myosin binding protein c 1h9v 
Human fc-gamma-receptor iia (fcgriia), monoclinic 1hkf 
The three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity 1hng 
Crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2 1hxm 
Crystal structure of a human vgamma9/vdelta2 t cell receptor 1i8l 
Human b7-1/ctla-4 co-stimulatory complex 1ij9 
Highly hydrated human vcam-1 fragment 1im9 
Crystal structure of the human natural killer cell inhibitory receptor kir2dl1 bound to its mhc ligand hla-cw4 1ira 
Complex of the interleukin-1 receptor with the interleukin- receptor antagonist (il1ra) 1itb 
Type-1 interleukin-1 receptor complexed with interleukin-1 beta 1j8h 
Crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4 1jew 
Cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car). 1kac 
Knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car 1kb5 
Murine t-cell receptor variable domain/fab complex 1kj2 
Murine alloreactive scfv tcr-peptide-mhc class i molecule complex 1lp9 
Xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1 1m4k 
Crystal structure of the human natural killer cell activator receptor kir2ds2 (cd158j) 1nam 
Murine alloreactive scfv tcr-peptide-mhc class i molecule complex 1nez 
The crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co- receptor preference and affinity 1nfd 
An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody 1nko 
Energetic and structural basis of sialylated oligosaccharide recognition by the natural killer cell inhibitory receptor p75/airm1 or siglec-7 1nkr 
Inhibitory receptor (p58-cl42) for human natural killer cells 1npu 
Crystal structure of the extracellular domain of murine pd-1 1o7s 
High resolution structure of siglec-7 1o7v 
High resolution structure of siglec-7 1od7 
N-terminal of sialoadhesin in complex with me-a-9-n- (naphthyl-2-carbonyl)-amino-9-deoxy-neu5ac (nap compound) 1od9 
N-terminal of sialoadhesin in complex with me-a-9-n-benzoyl-amino-9-deoxy-neu5ac (benz compound) 1oda 
N-terminal of sialoadhesin in complex with me-a-9-n- (biphenyl-4-carbonyl)-amino-9-deoxy-neu5ac (bip compound) 1oll 
Extracellular region of the human receptor nkp46 1olz 
The ligand-binding face of the semaphorins revealed by the high resolution crystal structure of sema4d 1ovz 
Crystal structure of human fcari 1ow0 
Crystal structure of human fcari bound to iga1-fc 1p53 
The crystal structure of icam-1 d3-d5 fragment 1p69 
Structural basis for variation in adenovirus affinity for the cellular receptor car (p417s mutant) 1p6a 
Structural basis for variation in asdenovirus affinity for the cellular receptor car (s489y mutant) 1p6f 
Structure of the human natural cytotoxicity receptor nkp46 1p7q 
Crystal structure of hla-a2 bound to lir-1, a host and viral mhc receptor 1pd6 
The nmr structure of domain c2 of human cardiac myosin binding protein c 1q8m 
Crystal structure of the human myeloid cell activating receptor trem-1 1qa9 
Structure of a heterophilic adhesion complex between the human cd2 and cd58(lfa-3) counter-receptors 1qfo 
N-terminal domain of sialoadhesin (mouse) in complex with 3'sialyllactose 1qfp 
N-terminal domain of sialoadhesin (mouse) 1qsv 
The vegf-binding domain of flt-1, 20 nmr structures 1qsz 
The vegf-binding domain of flt-1 (minimized mean) 1qty 
Vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor 1rsf 
Nmr structure of monomeric car d1 domain 1rv6 
Crystal structure of plgf in complex with domain 2 of vegfr1 1smo 
Crystal structure of human triggering receptor expressed on myeloid cells 1 (trem-1) at 1.47 . 1sq2 
Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lyxozyme 1t6v 
Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lysozyme 1t83 
Crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (orthorhombic) 1t89 
Crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal) 1tit 
Titin, ig repeat 27, nmr, minimized average structure 1tiu 
Titin, ig repeat 27, nmr, 24 structures 1u9k 
Crystal structure of mouse triggering receptor expressed on myeloid cells 1 (trem-1) at 1.76 1uct 
Crystal structure of the extracellular fragment of fc alpha receptor i (cd89) 1ufu 
Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ilt2; lir-1) 1ugn 
Crystal structure of lir1.02, one of the alleles of lir1 1url 
N-terminal domain of sialoadhesin (mouse) in complex with glycopeptide 1vca 
Crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution 1vdg 
Crystal structure of lir1.01, one of the alleles of lir1 1ver 
Structure of new antigen receptor variable domain from sharks 1ves 
Structure of new antigen receptor variable domain from sharks 1vsc 
Vcam-1 1waa 
Ig27 protein domain 1wit 
Twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, minimized average structure 1wiu 
Twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, 30 structures 1x44 
Solution structure of the third ig-like domain of myosin- dinding protein c, slow-type 1xau 
Structure of the btla ectodomain 1xed 
Crystal structure of a ligand-binding domain of the human polymeric ig receptor, pigr 1xt5 
Crystal structure of vcbp3, domain 1, from branchiostoma floridae 1ypz 
Immune receptor 1z2k 
Nmr structure of the d1 domain of the natural killer cell receptor, 2b4 1z7z 
Cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi 1z9m 
Crystal structure of nectin-like molecule-1 protein domain 1 1zgl 
Crystal structure of 3a6 tcr bound to mbp/hla-dr2a 1zox 
Clm-1 mouse myeloid receptor extracellular domain 2arj 
Cd8alpha-alpha in complex with yts 105.18 fab 2atp 
Crystal structure of a cd8ab heterodimer 2avg 
Nmr structure of cc1 domain from human cardiac myosin binding protein c 2aw2 
Crystal structure of the human btla-hvem complex 2bk8 
M1 domain from titin 2bve 
Structure of the n-terminal of sialoadhesin in complex with 2-phenyl-prop5ac 2c5d 
Structure of a minimal gas6-axl complex 2c9a 
Crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu 2coq 
Structure of new antigen receptor variable domain from sharks 2cqv 
Solution structure of the eighth ig-like domain of human myosin light chain kinase 2cr6 
Solution structure of the ig domain (2998-3100) of human obscurin 2cry 
Solution structure of the fifth ig-like domain of human kin of irre like 3 2d9c 
Solution structure of the first ig-like domain of signal- regulatory protein beta-1 (sirp-beta-1) 2dav 
Solution structure of the first ig-like domain of myosin- binding protein c, slow-type 2df3 
The structure of siglec-7 in complex with alpha(2,3) /alpha(2,6) disialyl lactotetraosyl 2-(trimethylsilyl)ethyl 2dks 
Solution structure of the first ig-like domain of human carcinoembryonic antigen related cell adhesion molecule 8 2dku 
Solution structure of the third ig-like domain of human kiaa1556 protein 2dl2 
Killer immunoglobulin receptor 2dl2 2dli 
Killer immunoglobulin receptor 2dl2,trigonal form 2dlt 
Solution structure of the ig-like domain(433- 525) of murine myosin-binding protein c, fast-type 2dru 
Crystal structure and binding properties of the cd2 and cd244 (2b4) binding protein, cd48 2dyp 
Crystal structure of lilrb2(lir2/ilt4/cd85d) complexed with hla-g 2e5e 
Solution structure of variable-type domain of human receptor for advanced glycation endproducts 2e6p 
Solution structure of the ig-like domain (714-804) from human obscurin-like protein 1 2e7b 
Solution structure of the 6th ig-like domain from human kiaa1556 2e7c 
Solution structure of the 6th ig-like domain from human myosin-binding protein c, fast-type 2edh 
Solution structure of the pdz domain (3614- 3713 ) from human obscuring 2edk 
Solution structure of the third ig-like domain from human myosin-binding protein c, fast-type 2edn 
Solution structure of the first ig-like domain from human myosin-binding protein c, fast-type 2edo 
Solution structure of the first ig-like domain from human cd48 antigen 2edq 
Solution structure of the ig-like domain (3713-3806) of human obscurin 2edr 
Solution structure of the ig-like domain (3361-3449) of human obscurin 2edt 
Solution structure of the ig-like domain (3449-3537) from human obscurin 2eny 
Solution structure of the ig-like domain (2735-2825) of human obscurin 2eo1 
Solution structure of the ig domain of human obscn protein 2esv 
Structure of the hla-e-vmaprtlil/kk50.4 tcr complex 2fbo 
Crystal structure of the two tandem v-type regions of vcbp3 (v-region-containing chitin binding protein) to 1.85 a 2fcb 
Human fc gamma receptor iib ectodomain (cd32) 2frg 
Structure of the immunoglobulin-like domain of human tlt-1 2g5r 
Crystal structure of siglec-7 in complex with methyl-9- (aminooxalyl-amino)-9-deoxyneu5ac (oxamido-neu5ac) 2gi7 
Crystal structure of human platelet glycoprotein vi (gpvi) 2gk2 
Crystal structure of the n terminal domain of human ceacam1 2gqh 
Solution structure of the 15th ig-like domain of human kiaa1556 protein 2gw5 
Crystal structure of lir-2 (ilt4) at 1.8 : differences from lir-1 (ilt2) in regions implicated in the binding of the cytomegalovirus class i mhc homolog ul18 2hrl 
Siglec-7 in complex with gt1b 2i24 
Crystal structure analysis of the nurse shark new antigen receptor pbla8 variable domain 2i25 
Crystal structure analysis of the nurse shark new antigen receptor pbla8 variable domain in complex with lysozyme 2i26 
Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme 2i27 
Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain 2ial 
Structural basis for recognition of mutant self by a tumor- specific, mhc class ii-restricted tcr 2iam 
Structural basis for recognition of mutant self by a tumor- specific, mhc class ii-restricted tcr 2ian 
Structural basis for recognition of mutant self by a tumor- specific, mhc class ii-restricted tcr 2icc 
Extracellular domain of crig 2ice 
Crig bound to c3c 2icf 
Crig bound to c3b 2if7 
Crystal structure of ntb-a 2ifg 
Structure of the extracellular segment of human trka in complex with nerve growth factor 2ij0 
Structural basis of t cell specificity and activation by the bacterial superantigen toxic shock syndrome toxin-1 2ill 
Anomalous substructure of titin-a168169 2j12 
Ad37 fibre head in complex with car d1 2j1k 
Cav-2 fibre head in complex with car d1 2j8h 
Structure of the immunoglobulin tandem repeat a168-a169 of titin 2j8o 
Structure of the immunoglobulin tandem repeat of titin a168- a169 2j8u 
Large cdr3a loop alteration as a function of mhc mutation. 2jcc 
Ah3 recognition of mutant hla-a2 w167a 2jjs 
Structure of human cd47 in complex with human signal regulatory protein (sirp) alpha 2jjt 
Structure of human cd47 in complex with human signal regulatory protein (sirp) alpha 2jju 
Structure of human signal regulatory protein (sirp) beta 2jjv 
Structure of human signal regulatory protein (sirp) beta(2) 2jjw 
Structure of human signal regulatory protein (sirp) gamma 2k1m 
3d nmr structure of domain cc0 of cardiac myosin binding protein c (mybpc) 2kdg 
Solution structure of the 1st ig domain of myotilin 2nms 
The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells irem-1 2nzi 
Crystal structure of domains a168-a170 from titin 2ocw 
Solution structure of human secretory component 2ol3 
Crystal structure of bm3.3 scfv tcr in complex with pbm8-h- 2kbm8 mhc class i molecule 2or7 
Tim-2 2or8 
Tim-1 2otp 
Crystal structure of immunoglobulin-like transcript 1 (ilt1/lir7/lilra2) 2oyp 
T cell immunoglobulin mucin-3 crystal structure revealed a galectin-9-independent binding surface 2oz4 
Structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization 2pet 
Lutheran glycoprotein, n-terminal domains 1 and 2. 2pf6 
Lutheran glycoprotein, n-terminal domains 1 and 2 2pkd 
Crystal structure of cd84: insite into slam family function 2pnd 
Structure or murine crig 2ptt 
Structure of nk cell receptor 2b4 (cd244) bound to its ligand cd48 2ptu 
Structure of nk cell receptor 2b4 (cd244) 2ptv 
Structure of nk cell receptor ligand cd48 2pxy 
Crystal structures of immune receptor complexes 2q87 
The crystal structure of the human irp60 ectodomain 2qhl 
Crystal structure of novel immune-type receptor 10 extracellular fragment from ictalurus punctatus 2qjd 
Crystal structure of novel immune-type receptor 10 extracellular fragment mutant n30d 2qqq 
Crystal structure of novel immune-type receptor 11 extracellular fragment from ictalurus punctatus 2qte 
Crystal structure of novel immune-type receptor 11 extracellular fragment mutant n30d 2uv3 
Structure of the signal-regulatory protein (sirp) alpha domain that binds cd47. 2uwe 
Large cdr3a loop alteration as a function of mhc mutation 2v5y 
Crystal structure of the receptor protein tyrosine phosphatase mu ectodomain 2v6h 
Crystal structure of the c1 domain of cardiac myosin binding protein-c 2vsd 
Crystal structure of chir-ab1 2w9l 
Canine adenovirus type 2 fibre head in complex with car domain d1 and sialic acid 2wbw 
Ad37 fibre head in complex with car d1 and sialic acid 2yuv 
Solution structure of 2nd immunoglobulin domain of slow type myosin-binding protein c 2yuz 
Solution structure of 4th immunoglobulin domain of slow type myosin-binding protein c 2ywy 
Structure of new antigen receptor variable domain from sharks 2ywz 
Structure of new antigen receptor variable domain from sharks 2yxm 
Crystal structure of i-set domain of human myosin binding proteinc 2yz1 
Crystal structure of the ligand-binding domain of murine shps-1/sirp alpha 2yz8 
Crystal structure of the 32th ig-like domain of human obscurin (kiaa1556) 2z31 
Crystal structure of immune receptor complex 2z35 
Crystal structure of immune receptor 2z8v 
Structure of an ignar-ama1 complex 2z8w 
Structure of an ignar-ama1 complex 2zg1 
Crystal structure of two n-terminal domains of siglec-5 in complex with 6'-sialyllactose 2zg2 
Crystal structure of two n-terminal domains of native siglec-5 2zg3 
Crystal structure of two n-terminal domains of native siglec-5 in complex with 3'-sialyllactose 2zwn 
Crystal structure of the novel two-domain type laccase from a metagenome 3b5h 
Crystal structure of the extracellular portion of hab18g/cd147 3b5t 
Crystal structure of novel immune-type receptor 10 se-met extracellular fragment mutant n30d 3b9k 
Crystal structure of cd8alpha-beta in complex with yts 156.7 fab 3bdb 
Crystal structure of novel immune-type receptor 11 extracellular fragment from ictalurus punctatus including stalk region 3bfo 
Crystal structure of ig-like c2-type 2 domain of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1 3bi9 
Tim-4 3bia 
Tim-4 in complex with sodium potassium tartrate 3bib 
Tim-4 in complex with phosphatidylserine 3bik 
Crystal structure of the pd-1/pd-l1 complex 3bis 
Crystal structure of the pd-l1 3bov 
Crystal structure of the receptor binding domain of mouse pd-l2 3bp5 
Crystal structure of the mouse pd-1 and pd-l2 complex 3bp6 
Crystal structure of the mouse pd-1 mutant and pd-l2 complex 3c5z 
Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506 3c60 
Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62 3chn 
Solution structure of human secretory iga1 3cjj 
Crystal structure of human rage ligand-binding domain 3cm9 
Solution structure of human siga2 3cx2 
Crystal structure of the c1 domain of cardiac isoform of myosin binding protein-c at 1.3a 3d2u 
Structure of ul18, a peptide-binding viral mhc mimic, bound to a host inhibitory receptor 3d5o 
Structural recognition and functional activation of fcrr by innate pentraxins 3dmm 
Crystal structure of the cd8 alpha beta/h-2dd complex 3dx9 
Crystal structure of the dm1 tcr at 2.75a 3dxa 
Crystal structure of the dm1 tcr in complex with hla-b*4405 and decamer ebv antigen 3gsn 
Crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope 3h8n 
Crystal structure analysis of kir2ds4 3he6 
Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr 3he7 
Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr 3irg 
High resolution structure of human titin in complex with obscurin like 1 - Links (links to other resources describing this domain)
-
PFAM ig INTERPRO IPR003599
