The domain within your query sequence starts at position 122 and ends at position 206; the E-value for the IG_like domain shown below is 1.09e2.

GLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYH
RLCVRCAAQRDGTWLHSDKFTLKVR

IG_like

Immunoglobulin like
IG_like
SMART accession number:SM00410
Description: IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Family alignment:
View or

There are 23925 IG_like domains in 15485 proteins in SMART's nrdb database.

Click on the following links for more information.