The domain within your query sequence starts at position 105 and ends at position 172; the E-value for the IGc2 domain shown below is 2.72e-5.

SLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYT
CVAKNIVA

IGc2

Immunoglobulin C-2 Type
IGc2
SMART accession number:SM00408
Description: -
Interpro abstract (IPR003598):

The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 ), C1-set (constant-1; IPR003597 ), C2-set (constant-2; IPR008424 ) and I-set (intermediate; IPR013098 ) [ (PUBMED:9417933) ]. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [ (PUBMED:15327963) (PUBMED:11377196) ].

Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [ (PUBMED:10698639) ].

This entry represents a subtype of the immunoglobulin domain, and is found in a diverse range of protein families that includes glycoproteins, fibroblast growth factor receptors, vascular endothelial growth factor receptors, interleukin-6 receptor, and neural cell adhesion molecules. It also includes proteins that are classified as unassigned proteinase inhibitors belonging to MEROPS inhibitor families I2, I17 and I43 [ (PUBMED:14705960) ].

Family alignment:
View or

There are 363480 IGc2 domains in 114582 proteins in SMART's nrdb database.

Click on the following links for more information.