The domain within your query sequence starts at position 43 and ends at position 190; the E-value for the IL1 domain shown below is 7.91e-5.
RETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLG IQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGH YIASSKTGNPIFLTSKKGEYYNINFNLD
IL1Interleukin-1 homologues |
---|
SMART accession number: | SM00125 |
---|---|
Description: | Cytokines with various biological functions. Interluekin 1 alpha and beta are also known as hematopoietin and catabolin. |
Family alignment: |
There are 2006 IL1 domains in 2001 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
-
Taxonomic distribution of proteins containing IL1 domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with IL1 domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing IL1 domain in the selected taxonomic class.
- Literature (relevant references for this domain)
-
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
- Dinarello CA
- Interleukin-1.
- Cytokine Growth Factor Rev. 1997; 8: 253-65
- Display abstract
Interleukin-1 (IL-1) is the prototypic pro-inflammatory cytokine. There are two forms of IL-1, IL-1alpha and IL-1beta and in most studies, their biological activities are indistinguishable. IL-1 affects nearly every cell type, often in concert with another pro-inflammatory cytokine, tumor necrosis factor (TNF). Although IL-1 can upregulate host defenses and function as an immunoadjuvant, IL-1 is a highly inflammatory cytokine. The margin between clinical benefit and unacceptable toxicity in humans is exceedingly narrow. In contrast, agents that reduce the production and/or activity of IL-1 are likely to have an impact on clinical medicine. The synthesis, processing, secretion and activity of IL-1, particularly IL-1beta, are tightly regulated events. A unique aspect of cytokine biology is the naturally occurring IL-1 receptor antagonist (IL-1Ra). IL-1Ra is structurally similar to IL-1beta but lacking agonist activity is used in clinical trials to reduce disease severity. In addition, regulation of IL-1 activity extends to low numbers of surface receptors, circulating soluble receptors and a cell surface "decoy" receptor to down-regulate responses to IL-1beta. This review updates the current knowledge on IL-1.
- Patarca R, Fletcher MA
- Interleukin-1: basic science and clinical applications.
- Crit Rev Oncog. 1997; 8: 143-88
- Kurzrock R, Wetzler M, Estrov Z, Talpaz M
- Interleukin-1 and its inhibitors: a biologic and therapeutic model for the role of growth regulatory factors in leukemias.
- Cytokines Mol Ther. 1995; 1: 177-84
- Display abstract
Production of growth factors may provide a mechanism for disease evolution in some leukemias. Interleukin-1 is a plelotropic cytokine with the ability to synergize with other growth factors as well as to stimulate their production and release. Autocrine and/or paracrine secretion of interleukin-1 has been implicated in the pathogenesis of both chronic and acute myelogenous leukemia. Recently, a series of both specific and nonspecific IL-1 inhibitory molecules have been identified. These include IL-1 receptor antagonist, soluble IL-1 receptors, IL-1-converting enzyme inhibitor, IL-4, IL-10 and IL-1-antisense. Early experiments demonstrating the ability of some of these molecules to inhibit acute and chronic myelogenous leukemia growth suggest that clinical trials of these compounds may provide a novel management approach in these malignancies. Here we review the potential biologic and therapeutic role of IL-1 and its inhibitors in the myeloid leukemias.
- Metabolism (metabolic pathways involving proteins which contain this domain)
-
Click the image to view the interactive version of the map in iPath% proteins involved KEGG pathway ID Description 19.19 map04060 Cytokine-cytokine receptor interaction 15.15 map04640 Hematopoietic cell lineage 15.15 map04010 MAPK signaling pathway 15.15 map04210 Apoptosis 15.15 map04940 Type I diabetes mellitus 9.09 map04620 Toll-like receptor signaling pathway 9.09 map05010 Alzheimer's disease 1.01 map00970 Aminoacyl-tRNA biosynthesis 1.01 map00290
Valine, leucine and isoleucine biosynthesis This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with IL1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing IL1 domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.
- Structure (3D structures containing this domain)
3D Structures of IL1 domains in PDB
PDB code Main view Title 1hib THE STRUCTURE OF AN INTERLEUKIN-1 BETA MUTANT WITH REDUCED BIOACTIVITY SHOWS MULTIPLE SUBTLE CHANGES IN CONFORMATION THAT AFFECT PROTEIN-PROTEIN RECOGNITION 1i1b CRYSTAL STRUCTURE OF RECOMBINANT HUMAN INTERLEUKIN-1BETA AT 2.0 ANGSTROMS RESOLUTION 1ilr CRYSTAL STRUCTURE OF THE INTERLEUKIN-1 RECEPTOR ANTAGONIST 1ilt X-RAY STRUCTURE OF INTERLEUKIN-1 RECEPTOR ANTAGONIST AT 2.0 ANGSTROMS RESOLUTION 1iob INTERLEUKIN-1 BETA FROM JOINT X-RAY AND NMR REFINEMENT 1ira COMPLEX OF THE INTERLEUKIN-1 RECEPTOR WITH THE INTERLEUKIN-1 RECEPTOR ANTAGONIST (IL1RA) 1irp SOLUTION STRUCTURE OF HUMAN INTERLEUKIN-1 RECEPTOR ANTAGONIST PROTEIN 1itb TYPE-1 INTERLEUKIN-1 RECEPTOR COMPLEXED WITH INTERLEUKIN-1 BETA 1j0s Solution structure of the human interleukin-18 1l2h Crystal structure of Interleukin 1-beta F42W/W120F mutant 1md6 High resolution crystal structure of murine IL-1F5 reveals unique loop conformation for specificity 1s0l Interleukin 1 beta mutant F42W 1t4q Interleukin 1 beta F101W 1too Interleukin 1B Mutant F146W 1tp0 Triple mutation in interleukin 1 beta cavity:replacement of phenylalanines with tryptophan. 1twe INTERLEUKIN 1 BETA MUTANT F101Y 1twm Interleukin-1 Beta Mutant F146Y 21bi INTERLEUKIN-1 BETA (IL-1 BETA) (MUTANT WITH CYS 71 REPLACED BY ALA) (C71A) 2i1b CRYSTALLOGRAPHIC REFINEMENT OF INTERLEUKIN-1 BETA AT 2.0 ANGSTROMS RESOLUTION 2ila STRUCTURE OF INTERLEUKIN 1ALPHA AT 2.7-ANGSTROMS RESOLUTION 2irt INITIAL CRYSTALLOGRAPHIC ANALYSES OF A RECOMBINANT INTERLEUKIN-1 RECEPTOR ANTAGONIST PROTEIN 2kh2 Solution structure of a scFv-IL-1B complex 2kki Solution structure of human Interleukin 1a 2l5x Solution structure of IL1A-S100A13 complex 2mib THE STRUCTURE OF MURINE INTERLEUKIN-1 BETA AT 2.8 ANGSTROMS RESOLUTION 2nvh Determination of Solvent Content in Cavities in Interleukin-1 Using Experimentally-Phased Electron Density 2vxt Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab 2wry Crystal structure of chicken cytokine interleukin 1 beta 31bi INTERLEUKIN-1 BETA (IL-1 BETA) (MUTANT WITH CYS 71 REPLACED BY SER) (C71S) 3f62 Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein 3ltq Structure of Interleukin 1B solved by SAD using an inserted Lanthanide Binding Tag 3nj5 Crystal structure of chicken IL-1 hydrophobic cavity mutant 157 3o4o Crystal structure of an Interleukin-1 receptor complex 3pok Interleukin-1-beta LBT L3 Mutant 3wo2 3WO2 3wo3 3WO3 3wo4 3WO4 41bi INTERLEUKIN-1 BETA (IL-1 BETA) (MUTANT WITH CYS 8 REPLACED BY ALA (C8A) 4dep Structure of the IL-1b signaling complex 4g6j Crystal structure of human IL-1beta in complex with the therapeutic antibody binding fragment of canakinumab 4g6m Crystal strucure of human IL-1beta in complex with therapeutic antibody binding fragment of gevokizumab 4gaf Crystal structure of EBI-005, a chimera of human IL-1beta and IL-1Ra, bound to human Interleukin-1 receptor type 1 4gai Crystal structure of EBI-005, a chimera of human IL-1beta and IL-1Ra 4hjj Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule 4i1b FUNCTIONAL IMPLICATIONS OF INTERLEUKIN-1BETA BASED ON THE THREE-DIMENSIONAL STRUCTURE 4ize 4IZE 4p0j 4P0J 4p0k 4P0K 4p0l 4P0L 4r6u 4R6U 4x37 4X37 4x38 4X38 4x39 4X39 4x3a 4X3A 4xfs 4XFS 5bow 5BOW 5bvp 5BVP 5i1b A COMPARISON OF THE HIGH RESOLUTION STRUCTURES OF HUMAN AND MURINE INTERLEUKIN-1B 6i1b HIGH-RESOLUTION THREE-DIMENSIONAL STRUCTURE OF INTERLEUKIN-1 BETA IN SOLUTION BY THREE-AND FOUR-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY 7i1b HIGH-RESOLUTION THREE-DIMENSIONAL STRUCTURE OF INTERLEUKIN-1 BETA IN SOLUTION BY THREE-AND FOUR-DIMENSIONAL NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY 8i1b A COMPARISON OF THE HIGH RESOLUTION STRUCTURES OF HUMAN AND MURINE INTERLEUKIN-1B 9ilb HUMAN INTERLEUKIN-1 BETA - Links (links to other resources describing this domain)
-
PROSITE IL1_DOMAIN