The domain within your query sequence starts at position 1 and ends at position 131; the E-value for the IL4_13 domain shown below is 8.65e-64.
MALWVTAVLALACLGGLAAPGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVD LAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLS YTKQLFRHGPF
IL4_13Interleukins 4 and 13 |
---|
SMART accession number: | SM00190 |
---|---|
Description: | Interleukins-4 and -13 are cytokines involved in inflammatory and immune responses. IL-4 stimulates B and T cells. |
Interpro abstract (IPR001325): | Interleukin-4 (IL-4) is a cytokine that plays a central role in the control and regulation of the immune and inflammatory system [ (PUBMED:3284813) (PUBMED:1693082) ]. IL-4 is a participant in several B-cell activation processes. It also stimulates other cell types such as T cells or mast cells. IL-4 is a glycoprotein that contains three disulphide bonds [ (PUBMED:1993171) ]. Interleukin-13 (IL-13) is a pleiotropic cytokine which may be important in the regulation of the inflammatory and immune responses [ (PUBMED:8096327) ]. The sequences of IL-4 and IL-13 are distantly related. This entry represetns both IL-4 and IL-13. |
GO process: | immune response (GO:0006955) |
GO component: | extracellular region (GO:0005576) |
GO function: | cytokine receptor binding (GO:0005126) |
Family alignment: |
There are 277 IL4_13 domains in 277 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)