The domain within your query sequence starts at position 32 and ends at position 158; the E-value for the Jacalin domain shown below is 5.04e-2.

GKHSCTSTPEEKNITSIRVFLQARSIVGIQFNYDDKDGQVYGSTAGKEMVARLSKEEHIT
GVEGSYSPSALTQIVFTTTQPRQLMVGYHVGIYQYSSYPDDPSFVLKGACVSWRAGGIKS
ILFLWGS

Jacalin

Jacalin-like lectin domain
Jacalin
SMART accession number:SM00915
Description: This entry represents a mannose-binding lectin domain with a beta-prism fold consisting of three 4-stranded beta-sheets, with an internal pseudo 3-fold symmetry. Some lectins in this group stimulate distinct T- and B- cell functions, such as Jacalin, which binds to the T-antigen and acts as an agglutinin. This domain is found in 1 to 6 copies in lectins. The domain is also found in the salt-stress induced protein from rice and an animal prostatic spermine-binding protein.
Interpro abstract (IPR001229):

The jacalin-like mannose-binding lectin domain has a beta-prism fold consisting of three 4-stranded beta-sheets, with an internal pseudo 3-fold symmetry. Some proteins with this domain stimulate distinct T- and B- cell functions, such as the plant lectin jacalin, which binds to the T-antigen and acts as an agglutinin. The domain can occur in tandem-repeat arrangements with up to six copies, and in architectures combined with a variety of other functional domains. While the family was initially named after an abundant protein found in the jackfruit seed, taxonomic distribution is not restricted to plants. The domain is also found in the salt-stress induced protein from rice and an animal prostatic spermine-binding protein. Proteins containing this domain include:

  • Jacalin, a tetrameric plant seed lectin and agglutinin from Artocarpus heterophyllus (jackfruit), which is specific for galactose [ (PUBMED:12206779) ].
  • Artocarpin, a tetrameric plant seed lectin from A. heterophyllus [ (PUBMED:15099743) ].
  • Lectin MPA, a tetrameric plant seed lectin and agglutinin from Maclura pomifera (Osage orange), [ (PUBMED:9497359) ].
  • Heltuba lectin, a plant seed lectin and agglutinin from Helianthus tuberosus (Jerusalem artichoke) [ (PUBMED:10647178) ].
  • Agglutinin from Calystegia sepium (Hedge bindweed) [ (PUBMED:14561768) ].
  • Griffithsin, an anti-viral lectin from red algae (Griffithsia species) [ (PUBMED:16843894) ].
Family alignment:
View or

There are 6537 Jacalin domains in 4554 proteins in SMART's nrdb database.

Click on the following links for more information.