The domain within your query sequence starts at position 18 and ends at position 134; the E-value for the Josephin domain shown below is 7e-33.
RQRLELCAVHALNNVLQEQLFSQEAADEICKRPLSQLALPQVLGLILNLPSPVSLGLLSL PLRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTK
Josephin |
---|
SMART accession number: | SM01246 |
---|---|
Description: | - |
Interpro abstract (IPR006155): | The Josephin domain is an eukaryotic protein module of about 180 residues, which occurs in stand-alone form in Josephin-like proteins, and as an amino- terminal domain associated with two or three copies of the ubiquitin- interacting motif (UIM) in ataxin 3-like proteins. Josephin domain-containing proteins function as de-ubiquitination enzymes [ (PUBMED:17696782) ]. Although it has originally been proposed that the Josephin domain could be an all-alpha helical domain distantly related to ENTH and VHS domains involved in membrane trafficking and regulatory adaptor function [ (PUBMED:12486728) ], it is now believed that it is a mainly alpha helical cysteine-protease domain predicted to be active against ubiquitin chains or related substrates [ (PUBMED:12944423) (PUBMED:14559776) ]. The Josephin domain contains two conserved histidines and one cysteine that is required for the ubiquitin protease activity [ (PUBMED:12944423) (PUBMED:14559776) ] and two ubiquitin-binding sites [ (PUBMED:19382171) ]. Some proteins known to contain a Josephin domain are:
|
GO process: | protein deubiquitination (GO:0016579) |
GO function: | thiol-dependent ubiquitin-specific protease activity (GO:0004843) |
Family alignment: |
There are 2629 Josephin domains in 2628 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)