The domain within your query sequence starts at position 18 and ends at position 176; the E-value for the Josephin domain shown below is 1.47e-81.

RQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAAL
QGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYY
NLDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTK

Josephin

Josephin
SMART accession number:SM01246
Description: -
Interpro abstract (IPR006155):

The Josephin domain is an eukaryotic protein module of about 180 residues, which occurs in stand-alone form in Josephin-like proteins, and as an amino- terminal domain associated with two or three copies of the ubiquitin- interacting motif (UIM) in ataxin 3-like proteins. Josephin domain-containing proteins function as de-ubiquitination enzymes [(PUBMED:17696782)]. Although it has originally been proposed that the Josephin domain could be an all-alpha helical domain distantly related to ENTH and VHS domains involved in membrane trafficking and regulatory adaptor function [(PUBMED:12486728)], it is now believed that it is a mainly alpha helical cysteine-protease domain predicted to be active against ubiquitin chains or related substrates [(PUBMED:12944423), (PUBMED:14559776)].

The Josephin domain contains two conserved histidines and one cysteine that is required for the ubiquitin protease activity [(PUBMED:12944423), (PUBMED:14559776)] and two ubiquitin-binding sites [(PUBMED:19382171)].

Some proteins known to contain a Josephin domain are:

  • Animal Machado-Joseph disease protein 1 (Ataxin 3). It interacts with key regulators (CBP, p300 and PCAF) of transcription and represses transcription.
  • Plant Machado-Joseph disease-like protein (MJD1a-like) (Ataxin 3 homologue).
  • Mammalian Josephin 1 and 2.
  • Drosophila melanogaster Josephin-like protein.
  • Arabidopsis thaliana Josephin-like protein.
GO process:protein deubiquitination (GO:0016579)
GO function:thiol-dependent ubiquitin-specific protease activity (GO:0004843)
Family alignment:
View or

There are 2629 Josephin domains in 2628 proteins in SMART's nrdb database.

Click on the following links for more information.