The domain within your query sequence starts at position 1587 and ends at position 1644; the E-value for the KASH domain shown below is 8.17e-34.

FLSRVIRAALPLQLLLLLLLLLACLLPASEDDYSCTQANNFARSFYPMLRYTNGPPPT

KASH

Nuclear envelope localisation domain
KASH
SMART accession number:SM01249
Description: The KASH (for Klarsicht/ANC-1/Syne-1 homology) or KLS domain is a highly hydrophobic nuclear envelope localisation domain of approximately 60 amino acids comprising a 20-amino-acid transmembrane region and a 30-35-residue C-terminal region that lies between the inner and the outer nuclear membranes (PMID:12169658). During meiotic prophase, telomeres cluster to form a bouquet arrangement of chromosomes. SUN and KASH domain proteins form complexes that span both membranes of the nuclear envelope. The KASH domain links the dynein motor complex of the microtubules, through the outer nuclear membrane to the Sad1 domain in the inner nuclear membrane which then interacts with the bouquet proteins Bqt1 and Bqt2 that are complexed with Bqt4, Rap1 and Taz1 and attached to the telomere (PMID:19948484). SUN domain-containing proteins are essential for recruiting KASH domain proteins at the outer nuclear membrane, and KASH domains provide a generic NE tethering device for functionally distinct proteins whose cytoplasmic domains mediate nuclear positioning, maintain physical connections with other cellular organelles, and possibly even influence chromosome dynamics (PMID:19687252).
Interpro abstract (IPR012315):

The KASH (Klarsicht/ANC-1/Syne-1 homology), or KLS domain is a highly hydrophobic nuclear envelope localization domain of approximately 60 amino acids comprising a 20-amino-acid transmembrane region and a 30-35-residue C-terminal region that lies between the inner and the outer nuclear membranes. The KASH domain is found in association with other domains, such as spectrin repeats and CH, at the C terminus of proteins tethered to the nuclear membrane in diverse cell types [ (PUBMED:10556085) (PUBMED:10878022) (PUBMED:12169658) (PUBMED:12408964) (PUBMED:15579692) ].

Some proteins known to contain a KASH domain are listed below:

  • Caenorhabditis elegans nuclear anchorage protein 1 (ANC-1).
  • Drosophila Klarsicht (Klar), a protein associated with nuclei and required for a subset of nuclear migrations.
  • Drosophila MSP-300.
  • Vetebrate nesprin-1, -2, -3 and -4 (also known as Syne1-4). They are components of the linker of the nucleoskeleton and cytoskeleton (LINC) complex, which plays critical roles in nuclear positioning, cell polarisation and cellular stiffness [ (PUBMED:22945352) ].

GO component:integral component of membrane (GO:0016021)
Family alignment:
View or

There are 2418 KASH domains in 2416 proteins in SMART's nrdb database.

Click on the following links for more information.